VIP and VIP agonists, nanoparticles, and uses in inflammatory T-cell mediated disease
In certain embodiments, this disclosure relates to VIP and VIP agonists, optionally conjugated to nanoparticles, for use in methods of treating inflammatory T cell-mediated diseases or conditions, e.g., treating or preventing GvHD. In certain embodiments, this disclosure relates to methods of pulmonary administration of VIP and VIP agonists, optionally conjugated to nanoparticles. In certain embodiments, this disclosure contemplates nanoparticles disclosed herein.
1 . A method of treating autoimmune diabetes, scleroderma, multiple sclerosis (MS), or graft versus host disease comprising administration an effective amount of an aerosolized form of a vasoactive intestinal polypeptide (VIP) agonist to a subject in need thereof, wherein the VIP agonist comprises an amino acid sequence (SEQ ID NO: 2), HSDAVFTDNYTRLRKQMAVKKYLNSILNGGGGSC.
2 . The method of claim 1 in which the vasoactive intestinal polypeptide or vasoactive intestinal polypeptide agonist is prepared as a dry powder with an inert carrier which is administered by a hand-held delivery device driven by compressed gas.
3 . The method of claim 1 in which the vasoactive intestinal polypeptide or vasoactive intestinal polypeptide agonist is dissolved in a solution of sterile saline and administered as an aerosol.