JNK3 inhibitory peptides
The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCPVAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and/or treatment of neurodegenerative or neurodevelopmental diseases.
1 . A peptide, natural or synthetic, comprising an amino acid sequence that has at least 80% sequence identity with the sequence
(SEQ ID NO: 1)
SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYK
CPVAQLE.
2 . The peptide according to claim 1 , which has at least 90% sequence identity with SEQ ID NO: 1.
3 . The peptide according to claim 1 , which has at least 95% sequence identity with SEQ ID NO: 1.
4 . The peptide according to claim 1 , which consists of SEQ ID NO: 1.
5 . The peptide according to claim 1 , which is conjugated to a polypeptide transport moiety.
6 . The peptide according to claim 5 , wherein said polypeptide transport moiety is TAT protein.
7 . A pharmaceutical composition comprising at least one peptide according to claim 1 and a pharmaceutically acceptable carrier.
8 . A method for treating an acute pathology of the nervous system of a subject, comprising administering an effective amount of a pharmaceutical composition comprising at least one peptide according to claim 6 and a pharmaceutically acceptable carrier to a subject in need thereof; wherein the acute pathology of the nervous system is selected from ischemia, traumatic brain injury, Alzheimer's, Parkinson's disease, Huntington's disease, frontotemporal dementia, Down syndrome, schizophrenia, spino-cerebellar ataxia, muscular atrophy, amyotrophic lateral sclerosis, progressive supranuclear palsy, corticobasal degeneration, Pick's disease, and prion diseases.
9 . The method according to claim 8 , wherein the acute pathology of the nervous system is Alzheimer's disease.
10 . The method according to claim 8 , wherein the acute pathology of the nervous system is traumatic brain injury.