Dual specificity antibodies and methods of making and using
View Patent ↗Antibodies having dual specificity for two different but structurally related antigens are provided. The antibodies can be, for example, entirely human antibodies, recombinant antibodies, or monoclonal antibodies. Preferred antibodies have dual specificity for IL-1α and IL-1β and neutralize IL-1α and IL-1β activity in vitro and in vivo. An antibody of the invention can be a full-length antibody or an antigen-binding portion thereof. Methods of making and methods of using the antibodies of the invention are also provided. The antibodies, or antibody portions, of the invention are useful for detecting two different but structurally related antigens (e.g., IL-1α and IL-1β ) and for inhibiting the activity of the antigens, e.g., in a human subject suffering from a disorder in which IL-1α and/or IL-1β activity is detrimental.
1. A method of obtaining a dual-specificity antibody that specifically binds interleukin-1α and interleukin-1β, the method comprising:
providing an antigen, wherein the antigen comprises the amino acid sequence TKGGQDITDFQILENQ (SEQ ID NO: 3);
exposing an antibody repertoire to the antigen; and
selecting from the repertoire an antibody that specifically binds IL-1α and IL-1β to thereby obtain the dual specificity antibody, wherein said dual-specificity antibody is not a fully mouse antibody.
2. The method of claim 1 , wherein the antigen is designed based on a contiguous topological area of identity between IL-1α and IL-1β.
3. The method of claim 2 , wherein the antigen comprises the amino acid sequence NEAQNITDF (SEQ ID NO: 1) or dNdEdAdQNITDF.
4. The method of claim 1 , wherein the antigen is designed based on structurally mimicking a loop of a common fold of IL-1α and IL-1β.
5. The method of claim 4 , wherein the antigen is a cyclic peptide comprising the amino acid sequence Cyclo-MAFLRANQNNGKISVAL(PG) (SEQ ID NO: 2).
6. The method of claim 1 , wherein the antigen comprises the amino acid sequence APVRSLNCTLRDSQQKSLVMSGPYELKALIILQGQDMEQQVVFSMGAYKSSKDDAKITVLLGL KEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKLEINNKLEFESAQFPNWYISTSQA ENMPVFLGGTKGGQDITDFTMQFVSS (SEQ ID NO: 4).
7. The method of claim 1 , wherein the antibody repertoire is exposed to the antigen in vivo by immunizing an animal with the antigen.
8. The method of claim 7 , which further comprises preparing a panel of hybridomas from lymphocytes of the animal and selecting a hybridoma that secretes an antibody that specifically binds IL-1α and IL-1β.
9. The method of claim 7 , wherein the animal is selected from the group consisting of mice, rats, rabbits and goats.
10. The method of claim 7 , wherein the animal is a knockout mouse deficient for IL-1α, IL-1β or both IL-1α and IL-1β.
11. The method of claim 7 , wherein the animal is a mouse that is transgenic for human immunoglobulin genes such that the mouse makes human antibodies upon antigenic stimulation.
12. The method of claim 7 , wherein the animal is a mouse with severe combined immunodeficiency (SCID) that has been reconstituted with human peripheral blood mononuclear cells or lymphoid cells or precursors thereof.
13. The method of claim 7 , wherein the animal is a mouse that has been treated with lethal total body irradiation, followed by radioprotection with bone marrow cells of a severe combined inimunodeficiency (SCID) mouse, followed by engraftment with functional human lymphocytes or precursors thereof.
14. The method of claim 1 , wherein the antibody repertoire is exposed to the antigen in vitro by screening a recombinant antibody library with the antigen.
15. The method of claim 14 , wherein the recombinant antibody library is expressed on the surface of bacteriophage.
16. The method of claim 14 , wherein the recombinant antibody library is expressed on the surface of yeast cells.
17. The method of claim 14 , wherein the recombinant antibody library is expressed on the surface of bacterial cells.
18. The method of claim 14 , wherein the recombinant antibody library is expressed as RNA-protein fusions.
19. The method of claim 14 , wherein the recombinant antibody library is a scFv library or a Fab library.
20. The method of claim 1 , wherein the antibody repertoire is exposed to the antigen by in vivo immunization of an animal with the antigen, followed by in vitro screening of a recombinant antibody library prepared from lymphoid cells of the animal with the antigen.
21. The method of claim 1 , wherein the antibody repertoire is exposed to the antigen by in vivo immunization of an animal with the antigen, followed by in vitro affinity maturation of a recombinant antibody library prepared from lymphoid cells of the animal.
22. The method of claim 1 , wherein the antibody repertoire is exposed to the antigen by in vivo immunization of an animal with the antigen, followed by selection of single cells secreting antibodies that bind the antigen and recovery of heavy- and light-chain variable region cDNAs from the single cells.
23. The method of claim 1 , wherein the dual-specificity antibody is a fully human antibody.
24. The method of claim 1 , wherein the dual-specificity antibody is a chimeric antibody.
25. The method of claim 1 , wherein the dual-specificity antibody is a CDR-grafted antibody.