Highly purified mocarhagin, a cobra venom protease, polynucleotides encoding same and related proteases, and therapeutic uses thereof
View Patent ↗Highly purified mocarhagin, a cobra venom protease, is disclosed. Pharmaceutical compositions and therapeutic uses of the highly purified protease are also provided. Polynucleotides encoding such protease and related proteases are also disclosed.
1. A composition comprising a mature mocarhagin protein at least 95% free of other cobra proteins and comprising an N terminal amino acid sequence chosen from:
a) amino acids 192 to 221 of SEQ ID NO: 6;
b) amino acids 192 to 221 of SEQ ID NO: 8;
c) amino acids 192 to 221 of SEQ ID NO: 10;
d) amino acids 192 to 221 of SEQ ID NO: 12;
e) amino acids 192 to 221 of SEQ ID NO: 14.
2. The composition of claim 1 , wherein said mocarhagin protein exhibits an IC50 of less than about 100 μg/mL in a neutrophil/HL60 binding inhibition assay.
3. The composition of claim 1 , wherein said mocarhagin protein is characterized by at least one characteristic selected from the group consisting of:
(a) a molecular weight of approximately 55 kDa under reducing conditions;
(b) a molecular weight of approximately 55 kDa under nonreducing conditions;
(c) an N-terminal amino acid sequence comprising TNTPEQDRYLQAKKYIEFYVVVDNVMYRKY (SEQ ID NO: 1);
(d) mocarhagin proteolytic activity;
(e) the ability to inhibit platelet binding to vWF;
(f) requirement of calcium ion for activity;
(g) requirement of zinc ion for activity;
(h) an activity substantially inhibited by excess EDTA; and
(i) an activity substantially inhibited by high concentrations of DFP.
4. The composition of claim 1 , wherein said mocarhagin protein is capable of cleaving a material selected from the group consisting of anionic polypeptides containing sulfated tyrosine residues, PSGL-1 and GP Ibα.
5. A composition comprising a therapeutically effective amount of a composition of claim 1 , and a pharmaceutically acceptable carrier.
6. A composition comprising a mature mocarhagin protein isolated from cobra venom by:
subjecting a composition comprising cobra venom to a heparin affinity chromatography column;
(b) subjecting the eluate from said heparin affinity column to a size exclusion column;
(c) subjecting the eluate from said size exclusion column to a Mono S column; and
(d) eluting said mocarhagin from said Mono S column; and wherein and the mature mocarhagin protein comprises an N terminal amino acid sequence chosen from:
a) amino acids 192 to 221 of SEQ ID NO: 6;
b) amino acids 192 to 221 of SEQ ID NO: 8;
c) amino acids 192 to 221 of SEQ ID NO: 10;
d) amino acids 192 to 221 of SEQ ID NO: 12;
e) amino acids 192 to 221 of SEQ ID NO: 14.
7. The composition of claim 6 further comprising a pharmaceutically acceptable carrier.
8. The composition of claim 2 , wherein said mocarhagin protein exhibits an IC50 of less than about 1 μg/mL in a neutrophil/HL60 binding inhibition assay.
9. The composition of claim 1 , wherein said mocarhagin protein is homogeneous.
10. The composition of claim 3 , wherein said protein comprises the amino acid sequence of SEQ ID NO:6 from amino acid 192 to amino acid 621.
11. A composition comprising a mocarhagin protein, wherein said protein comprises an amino acid sequence selected from the group consisting of:
(a) the amino acid sequence of SEQ ID NO:6;
(b) the amino acid sequence of SEQ ID NO:6 from amino acid 24 to amino acid 621;
(c) the amino acid sequence of SEQ ID NO:6 from amino acid 192 to amino acid 621;
(d) fragments of the amino acid sequence of SEQ ID NO:6 encoding a protein having mocarhagin activity; and
(e) the amino acid sequence encoded by the cDNA insert of clone NMM-1 deposited under accession number ATCC 209588; the protein being substantially free from other mammalian proteins.
12. The composition of claim 11 , wherein said protein comprises the amino acid sequence of SEQ ID NO:6.
13. A protein produced according to a process comprising:
(a) in a suitable culture medium, growing a culture of a host cell transformed with an isolated polynucleotide comprising the nucleotide sequence of SEQ ID NO:5 operably linked to an expression control sequence; and
(b) purifying the protein from the culture.
14. The protein of claim 13 comprising a mature protein.
15. A pharmaceutical composition comprising a protein of claim 11 and a pharmaceutically acceptable carrier.
16. A composition comprising a mocarhagin protein, wherein said protein comprises an amino acid sequence selected from the group consisting of:
(a) the amino acid sequence of SEQ ID NO:8;
(b) the amino acid sequence of SEQ ID NO:8 from amino acid 24 to amino acid 439;
(c) the amino acid sequence of SEQ ID NO:8 from amino acid 192 to amino acid 439;
(d) fragments of the amino acid sequence of SEQ ID NO:8 encoding a protein having mocarhagin activity; and
(e) the amino acid sequence encoded by the cDNA insert of clone NMM-2 deposited under accession number ATCC 209589; the protein being substantially free from other mammalian proteins.
17. The composition of claim 16 , wherein said protein comprises the amino acid sequence of SEQ ID NO: 8.
18. A protein produced according to a process comprising:
(a) in a suitable culture medium, growing a culture of a host cell transformed with an isolated polynucleotide comprising the nucleotide sequence of SEQ ID NO: 7 operably linked to an expression control sequence; and
(b) purifying the protein from the culture.
19. The protein of claim 18 comprising a mature protein.
20. A pharmaceutical composition comprising a protein of claim 16 and a pharmaceutically acceptable carrier.
21. A composition comprising a mocarhagin protein, wherein said protein comprises an amino acid sequence selected from the group consisting of:
(a) the amino acid sequence of SEQ ID NO: 10;
(b) the amino acid sequence of SEQ ID NO: 10 from amino acid 24 to amino acid 613;
(c) the amino acid sequence of SEQ ID NO: 10 from amino acid 192 to amino acid 613;
(d) fragments of the amino acid sequence of SEQ ID NO: 10 encoding a protein having mocarhagin activity; and
(e) the amino acid sequence encoded by the cDNA insert of clone NMM-9 deposited under accession number ATCC 209586; the protein being substantially free from other mammalian proteins.
22. The composition of claim 21 , wherein said protein comprises the amino acid sequence of SEQ ID NO: 10.
23. A protein produced according to a process comprising:
(a) in a suitable culture medium, growing a culture of a host cell transformed with an isolated polynucleotide comprising the nucleotide sequence of SEQ ID NO: 9 operably linked to an expression control sequence; and
(b) purifying the protein from the culture.
24. The protein of claim 23 comprising a mature protein.
25. A pharmaceutical composition comprising a protein of claim 21 and a pharmaceutically acceptable carrier.
26. A composition comprising a mocarhagin protein, wherein said protein comprises an amino acid sequence selected from the group consisting of:
(a) the amino acid sequence of SEQ ID NO: 12;
(b) the amino acid sequence of SEQ ID NO: 12 from amino acid 24 to amino acid 521;
(c) the amino acid sequence of SEQ ID NO: 12 from amino acid 192 to amino acid 521;
(d) fragments of the amino acid sequence of SEQ ID NO: 12 encoding a protein having mocarhagin activity; and
(e) the amino acid sequence encoded by the cDNA insert of clone NMM-12 deposited under accession number ATCC 209585; the protein being substantially free from other mammalian proteins.
27. The composition of claim 26 , wherein said protein comprises the amino acid sequence of SEQ ID NO: 12.
28. A protein produced according to a process comprising:
(a) in a suitable culture medium, growing a culture of a host cell transformed with an isolated polynucleotide comprising the nucleotide sequence of SEQ ID NO: 11 operably linked to an expression control sequence; and
(b) purifying the protein from the culture.
29. The protein of claim 28 comprising a mature protein.
30. A pharmaceutical composition comprising a protein of claim 26 and a pharmaceutically acceptable carrier.
31. A composition comprising a mocarhagin protein, wherein said protein comprises an amino acid sequence selected from the group consisting of:
(a) the amino acid sequence of SEQ ID NO: 14;
(b) the amino acid sequence of SEQ ID NO: 14 from amino acid 24 to amino acid 592;
(c) the amino acid sequence of SEQ ID NO: 14 from amino acid 192 to amino acid 592;
(d) fragments of the amino acid sequence of SEQ ID NO: 14 encoding a protein having mocarhagin activity; and
(e) the amino acid sequence encoded by the cDNA insert of clone NMM-13 deposited under accession number ATCC 209584; the protein being substantially free from other mammalian proteins.
32. The composition of claim 31 wherein said protein comprises the amino acid sequence of SEQ ID NO: 14.
33. A protein produced according to a process comprising:
(a) in a suitable culture medium, growing a culture of a host cell transformed with an isolated polynucleotide comprising the nucleotide sequence of SEQ ID NO: 13 operably linked to an expression control sequence; and
(b) purifying the protein from the culture.
34. The protein of claim 33 comprising a mature protein.
35. A pharmaceutical composition comprising a protein of claim 31 and a pharmaceutically acceptable carrier.
36. A composition comprising a mocarhagin protein, wherein said protein comprises an amino acid sequence selected from the group consisting of:
(a) the amino acid sequence of SEQ ID NO: 16;
(b) the amino acid sequence of SEQ ID NO: 16 from amino acid 62 to amino acid 462;
(c) fragments of the amino acid sequence of SEQ ID NO: 16 encoding a protein having mocarhagin activity; and
(d) the amino acid sequence encoded by the cDNA insert of clone NMM-3 deposited under accession number ATCC 209587; the protein being substantially free from other mammalian proteins.
37. The composition of claim 36 , wherein said protein comprises the amino acid sequence of SEQ ID NO: 16.
38. A protein produced according to a process comprising:
(a) in a suitable culture medium, growing a culture of a host cell transformed with an isolated polynucleotide comprising the nucleotide sequence of SEQ ID NO: 15 operably linked to an expression control sequence; and
(b) purifying the protein from the culture.
39. The protein of claim 38 comprising a mature protein.
40. A pharmaceutical composition comprising a protein of claim 36 and a pharmaceutically acceptable carrier.
41. A composition comprising a mocarhagin protein wherein said protein comprises an amino acid sequence selected from the group consisting of:
(a) the amino acid sequence of SEQ ID NO: 18;
(b) the amino acid sequence of SEQ ID NO: 18 from amino acid 197 to amino acid 621;
(c) fragments of the amino acid sequence of SEQ ID NO: 18 encoding a protein having mocarhagin activity; and
(d) the amino acid sequence encoded by the cDNA insert of clone NMM-9ek deposited under accession number ATCC 209583; the protein being substantially free from other mammalian proteins.
42. The composition of claim 41 , wherein said protein comprises the amino acid sequence of SEQ ID NO: 18.
43. A protein produced according to a process comprising:
(a) in a suitable culture medium, growing a culture of a host cell transformed with an isolated polynucleotide comprising the nucleotide sequence of SEQ ID NO:17 operably linked to an expression control sequence; and
(b) purifying the protein from the culture.
44. The protein of claim 43 comprising a mature protein.
45. A pharmaceutical composition comprising a protein of claim 41 and a pharmaceutically acceptable carrier.