IP Library Patent Application 10555735
Patent Application
App. No. 10/555,735

Synthetic chemokine receptor ligands and methods of use thereof

Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US None
App. No.
10/555,735
Abstract

The present invention provides synthetic CXCR3 ligands, including consensus CXCR3 ligands and hybrid CXCR3 ligands; and compositions comprising the ligands. The present invention provides polynucleotides encoding the synthetic CXCR3 ligands; expression vectors comprising the polynucleotides; and host cells comprising the polynucleotidess. The present invention provides methods of treating fibrotic disorders; methods of treating angiogenic disorders; methods of treating cancer; and methods of treating bacterial infections. The methods generally involve administering to an individual in need thereof an effective amount of a subject synthetic CXCR3 ligand. (SEQ ID NO: 15) MKKSGVLFLLGIILLVLIGVQGFPMFKRGRCLCIGPGVKPVNPRSLEKLE IIPASQFCPRIEIIATLKNGVQTCLNPDSKQARLIIKKVSKEMSKRSP

Claims (22)

1 . A synthetic CXCR3 polypeptide ligand comprising a polypeptide of from about 70 to about 125 amino acids in length, optionally further including an additional methionine attached to the ordinarily first amino acid at the N-terminus, the amino acid sequence of the polypeptide comprising, in sequence, discrete sub-sequences corresponding in amino acid identity and number to sub-sequences of different, naturally occurring CXCR3 ligands selected from IP-10, I-TAC, and Mig, where the amino acid sequence of the synthetic CXCR3 polypeptide differs from the amino acid sequence of naturally occurring CXCR3 ligands IP-10, I-TAC, and Mig.

2 . The synthetic CXCR3 polypeptide ligand of claim 1 , wherein the CXCR3 ligand comprises the amino acid sequence as set forth in any one of SEQ ID NOs:15-20.

3 . A synthetic CXCR3 ligand comprising a polypeptide of from about 70 to about 125 amino acids in length, optionally further including an additional methionine attached to the ordinarily first amino acid at the N-terminus, the amino acid sequence of the polypeptide comprising those amino acid residues that are common to IP-10, Mig, and I-TAC, and which comprises, at one or more of those positions where there is no amino acid common to IP-10, Mig, and I-TAC, an amino acid which predominantly occurs at that position.

4 . The synthetic CXCR3 polypeptide ligand of claim 3 , wherein the CXCR3 ligand comprises the amino acid sequence as set forth in any one of SEQ ID NO:01, 02, and 03.

5 . A composition comprising the synthetic CXCR3 ligand of any of claims 1 - 4 .

6 . A polynucleotide comprising a nucleotide sequence encoding a synthetic CXCR3 ligand of any of claims 1 - 4 .

7 . The polynucleotide of claim 6 , wherein-said synthetic CXCR3 ligand comprises the amino acid sequence set forth in any one of SEQ ID NO:01, 02, 03, 15, 16, 17, 18, 19, and 20.

8 . An expression vector comprising the polynucleotide of claim 6 operably linked to a promoter.

9 . A host cell comprising the polynucleotide of claim 6 .

10 . A host cell comprising the expression vector of claim 8 .

11 . A method for producing a synthetic CXCR3 ligand, the method comprising:

culturing the host cell of claim 10 under conditions that favor production of the synthetic CXCR3 ligand; and

isolating the synthetic CXCR3 ligand from the culture.

12 . An antibody that specifically binds a synthetic CXCR3 ligand of any one of claims 1 - 4 .

13 . A method of treating a fibrotic disease in an individual, the method comprising administering to an individual suffering from a fibrotic disease an amount of a synthetic CXCR3 ligand that is effective in the treatment or prophylaxis of the fibrotic disease in the individual.

14 . The method of claim 13 , wherein the fibrotic disease is pulmonary fibrosis.

15 . The method of claim 13 , wherein the pulmonary fibrosis is idiopathic pulmonary fibrosis.

16 . The method of claim 13 , wherein the pulmonary fibrosis is from a known etiology.

17 . The method of claim 13 , wherein the fibrotic disease is selected from liver fibrosis, renal fibrosis, cardiac fibrosis, and scleroderma.

18 . A method of reducing tumor growth in an individual having a tumor, the method comprising administering to the individual an effective amount of a synthetic CXCR3 ligand.

19 . The method of claim 18 , further comprising administering an effective amount of an anti-neoplastic agent selected from an alkylating agent, a nitrosourea, an antimetabolite, an antitumor antibiotic, a plant (vinca) alkaloid, a taxane, and a steroid hormone.

20 . The method of any of claims 13 - 19 , wherein the individual is a human.

Assignments (2)
CERTIFICATE OF CHANGE OF COMPANY'S ADDRESS Recorded Jul 27, 2018
From: INTERMUNE, INC.
To: INTERMUNE, INC.
Reel/Frame 046638/0466 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 7, 2008
From: BLATT, LAWRENCE M.
To: INTERMUNE, INC.
Reel/Frame 020480/0974 →