CA6 antigen-specific cytotoxic conjugate and methods of using the same
Cytotoxic conjugates comprising a cell binding agent and a cytotoxic agent, therapeutic compositions comprising the conjugate, methods for using the conjugates in the inhibition of cell growth and the treatment of disease, and a kit comprising the cytotoxic conjugate are disclosed are all embodiments of the invention. In particular, the cell binding agent is a monoclonal antibody, and epitope-binding fragments thereof, that recognizes and binds the CA6 glycotope. The present invention is also directed to humanized or resurfaced versions of DS6, an anti-CA6 murine monoclonal antibody, and epitope-binding fragments thereof.
1 . An antibody or epitope-binding fragment thereof comprising at least one complementarity-determining region having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-6:
SYNMH
(SEQ ID NO:1)
YIYPGNGATNYNQKFKG
(SEQ ID NO:2)
GDSVPFAY
(SEQ ID NO:3)
SAHSSVSFMH
(SEQ ID NO:4)
STSSLAS
(SEQ ID NO:5)
QQRSSFPLT.
(SEQ ID NO:6)
2 . An antibody or epitope-binding fragment thereof comprising at least one heavy chain variable region or fragment thereof and at least one light chain variable region or fragment thereof, wherein said at least one heavy chain variable region or fragment thereof comprises three sequential complementarity-determining regions having amino acid sequences represented by SEQ ID NOS:1-3, respectively:
SYNMH
(SEQ ID NO:1)
YIYPGNGATNYNQKFKG
(SEQ ID NO:2)
GDSVPFAY
(SEQ ID NO:3)
and wherein said at least one light chain variable region or fragment thereof comprises three sequential complementarity-determining regions having amino acid sequences represented by SEQ ID NOS:4-6, respectively:
SAHSSVSFMH
(SEQ ID NO:4)
STSSLAS
(SEQ ID NO:5)
QQRSSFPLT.
(SEQ ID NO:6)
3 . The antibody or epitope-binding fragment thereof of claim 2 , wherein said light chain variable region or fragment thereof has at least 90% sequence identity to an amino acid sequence represented by SEQ ID NO:7 or SEQ ID NO:8:
QIVLTQSPAIMSASPGEKVTITCSAHSSVSFMHWFQQKPGTSPKLWIYS
(SEQ ID NO:7)
TSSLASGVPARFGGSGSGTSYSLTISRMEAEDAATYYCQQRSSFPLTFG
AGTKLELKR
EIVLTQSPATMSASPGERVTITCSAHSSVSFMHWFQQKPGTSPKLWIYS
(SEQ ID NO:8)
TSSLASGVPARFGGSGSGTSYSLTISSMEAEDAATYYCQQRSSFPLTFG
AGTKLELKR.
4 . The antibody or epitope-binding fragment thereof of claim 3 , wherein said light chain variable region or fragment thereof has at least 95% sequence identity to the amino acid sequence of SEQ ID NO:7 or SEQ ID NO:8.
5 . The antibody or epitope-binding fragment thereof of claim 3 , wherein said light chain variable region or fragment thereof has the amino acid sequence of SEQ ID NO:7 or SEQ ID NO:8.
6 . The antibody or epitope-binding fragment thereof of claim 2 , wherein said heavy chain variable region or fragment thereof has at least 90% sequence identity to an amino acid sequence selected from a group consisting of SEQ ID NO:9, SEQ ID NO:10, and SEQ ID NO:1:
(SEQ ID NO:9)
QAYLQQSGAELVRSGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFKGKATLTADPSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA
(SEQ ID NO:10)
QAQLQVSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFQGKATLTADTSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA
(SEQ ID NO:11)
QAQLQVSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFQGKATLTADPSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA.
7 . The antibody or epitope-binding fragment thereof of claim 6 , wherein said heavy chain variable region or fragment thereof has at least 95% sequence identity to the amino acid sequence of SEQ ID NO:9, SEQ ID NO:10, or SEQ ID NO:11.
8 . The antibody or epitope-binding fragment thereof of claim 6 , wherein said heavy chain variable region or fragment thereof has the amino acid sequence of SEQ ID NO:9, SEQ ID NO:10, or SEQ ID NO:11.
9 . A polynucleotide encoding an antibody or an epitope-binding fragment of any one of claims 1 , 2 , 3 or 6 .
10 . A polynucleotide encoding a light or heavy chain of an antibody or an epitope-binding fragment of any one of claims 1 , 2 , 3 or 6 .
11 . A vector comprising the polynucleotide of claim 9 .
12 . A vector comprising the polynucleotide of claim 10 .
13 . The vector of claim 11 , wherein said vector is an expression vector that expresses said antibody or epitope-binding fragment.
14 . The vector of claim 12 , wherein said vector is an expression vector that expresses said antibody or epitope-binding fragment.
15 . A humanized rodent antibody or an epitope-binding fragment thereof that binds to CA6 glycotope, produced by a method of resurfacing comprising:
(a) generating position alignments from relative accessibility distributions from x-ray crystallographic structures of a pool of rodent and human antibody heavy and light chain variable regions to yield a set of heavy and light chain variable region framework surface exposed positions, wherein the alignment positions for all rodent and human variable regions are at least about 98% identical;
(b) defining for a rodent antibody or epitope-binding fragment thereof a set of heavy and light chain variable region framework surface exposed amino acid residues using said set of heavy and light chain variable region framework surface exposed positions generated in said step (a);
(c) identifying from human antibody amino acid sequences a set of heavy and light chain variable region framework surface exposed amino acid residues that is most closely identical to said set of rodent surface exposed amino acid residues defined in said step (b);
(d) substituting, in the variable region framework amino acid sequence of said rodent antibody or epitope-binding fragment thereof, said set of heavy and light chain variable region framework surface exposed amino acid residues defined in said step (b) with said set of heavy and light chain variable region framework surface exposed amino acid residues identified in said step (c);
(e) constructing three-dimensional models of said variable region of said rodent antibody or epitope-binding fragment thereof and of said variable region of said rodent antibody or epitope-binding fragment thereof resulting from the substituting specified in said step (d);
(f) comparing said three-dimensional models constructed in said step (e), and identifying any amino acid residues from said sets identified in said steps (b) or (c), that are within 5 Å of any atom of any residue of the complementarity determining regions of said rodent antibody or epitope-binding fragment thereof;
(g) changing any residues identified in said step (f) from the human to the original rodent amino acid residue to thereby define a humanizing set of surface exposed amino acid residues;
(h) replacing the set of rodent antibody variable region framework surface exposed amino acid residues defined in said step (b) with the humanizing set of variable region framework surface exposed amino acid residues defined in said step (g); and
(i) producing said humanized rodent antibody or epitope-binding fragment thereof that binds to the CA6 glycotope.
16 . The humanized rodent antibody or epitope-binding fragment thereof of claim 15 , wherein said humanized rodent antibody or epitope-binding fragment thereof is an epitope-binding fragment.
17 . The humanized rodent antibody or epitope-binding fragment thereof of claim 16 , wherein said epitope-binding fragment is selected from the group consisting of a Fab fragment, a Fab′ fragment, a F(ab′) 2 fragment, a Fd fragment, a single-chain Fvs (scFv) fragment, a single-chain antibody, a disulfide-linked Fvs (sdFv) fragment and a fragment comprising either a V L or V H domain.
18 . The humanized rodent antibody or epitope-binding fragment thereof of claim 15 or 16 , wherein said surface exposed amino acid residues are those residues whose solvent accessibility is above 30%.
19 . The humanized rodent antibody or epitope-binding fragment thereof of claim 15 , comprising at least one complementarity-determining region having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-6:
SYNMH
(SEQ ID NO:1)
YIYPGNGATNYNQKFKG
(SEQ ID NO:2)
GDSVPFAY
(SEQ ID NO:3)
SAHSSVSFMH
(SEQ ID NO:4)
STSSLAS
(SEQ ID NO:5)
QQRSSFPLT.
(SEQ ID NO:6)
20 . The humanized rodent antibody or epitope-binding fragment thereof of claim 15 , comprising at least one heavy chain variable region or fragment thereof and at least one light chain variable region or fragment thereof, wherein said at least one heavy chain variable region or fragment thereof comprises three sequential complementarity-determining regions having amino acid sequences represented by SEQ ID NOS:1-3, respectively:
SYNMH
(SEQ ID NO:1)
YIYPGNGATNYNQKFKG
(SEQ ID NO:2)
GDSVPFAY
(SEQ ID NO:3)
and wherein said at least one light chain variable region or fragment thereof comprises three sequential complementarity-determining regions having amino acid sequences represented by SEQ ID NOS:4-6, respectively:
SAHSSVSFMH
(SEQ ID NO:4)
STSSLAS
(SEQ ID NO:5)
QQRSSFPLT.
(SEQ ID NO:6)
21 . The humanized rodent antibody or epitope-binding fragment thereof of claim 15 , comprising a light chain variable region having an amino acid sequence of SEQ ID NO:7 or SEQ ID NO:8:
(SEQ ID NO:7)
QIVLTQSPAIMSASPGEKVTITCSAHSSVSFMHWFQQKPGTSPKLWIYS
TSSLASGVPARFGGSGSGTSYSLTISRMEAEDAATYYCQQRSSFPLTFG
AGTKLELKR
(SEQ ID NO:8)
EIVLTQSPATMSASPGERVTITCSAHSSVSFMHWFQQKPGTSPKLWIYS
TSSLASGVPARFGGSGSGTSYSLTISSMEAEDAATYYCQQRSSFPLTFG
AGTKLELKR.
22 . The humanized rodent antibody or epitope-binding fragment thereof of claim 15 , comprising a heavy chain variable region having an amino acid sequence selected from the group consisting of SEQ ID NO:9, SEQ ID NO:10 and SEQ ID NO:11:
(SEQ ID NO:9)
QAYLQQSGAELVRSGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFKGKATLTADPSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA
(SEQ ID NO:10)
QAQLQVSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFQGKATLTADTSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA
(SEQ ID NO:11)
QAQLQVSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFQGKATLTADPSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA.
23 . An improved antibody or epitope-binding fragment thereof that binds to a cell expressing CA6 glycotope, said improved antibody or epitope-binding fragment thereof produced by:
(a) providing a DNA polynucleotide encoding an antibody or epitope-binding fragment thereof comprising at least one sequence selected from the group consisting of SEQ ID NOs:1 to 11;
SYNMH
(SEQ ID NO:1)
YIYPGNGATNYNQKFKG
(SEQ ID NO:2)
GDSVPFAY
(SEQ ID NO:3)
SAHSSVSFMH
(SEQ ID NO:4)
STSSLAS
(SEQ ID NO:5)
QQRSSFPLT
(SEQ ID NO:6)
(SEQ ID NO:7)
QIVLTQSPAIMSASPGEKVTITCSAHSSVSFMHWFQQKPGTSPKLWIYS
TSSLASGVPARFGGSGSGTSYSLTISRMEAEDAATYYCQQRSSFPLTFG
AGTKLELKR
(SEQ ID NO:8)
EIVLTQSPATMSASPGERVTITCSAHSSVSFMHWFQQKPGTSPKLWIYS
TSSLASGVPARFGGSGSGTSYSLTISSMEAEDAATYYCQQRSSFPLTFG
AGTKLELKR
(SEQ ID NO:9)
QAYLQQSGAELVRSGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFKGKATLTADPSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA
(SEQ ID NO:10)
QAQLQVSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFQGKATLTADTSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA
(SEQ ID NO:11)
QAQLQVSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLE
WIGYIYPGNGATNYNQKFQGKATLTADPSSSTAYMQISSLTSEDSAVY
FCARGDSVPFAYWGQGTLVTVSA
(b) introducing at least one nucleotide mutation, deletion or insertion into said DNA polynucleotide of (a) such that at least one residue of the amino acid sequence encoded by said DNA polynucleotide is changed;
(c) expressing an antibody or antibody fragment encoded by the DNA polynucleotide of (b); and
(d) screening said expressed antibody or antibody fragment for an improvement in binding affinity to a cell expressing CA6 glycotope, thereby producing an improved antibody or epitope-binding fragment thereof.
24 . The improved antibody or epitope-binding fragment thereof of claim 23 , wherein said at least one nucleotide mutation, deletion or insertion is made by a method selected from the group consisting of oligonucleotide-mediated site-directed mutagenesis, cassette mutagenesis, error-prone PCR, DNA shuffling and the use of mutator-strains of E. coli.
25 . A cytotoxic conjugate comprising a cell binding agent and a cytotoxic agent, wherein said cell binding agent binds to CA6 glycotope.
26 . The cytotoxic conjugate according to claim 25 , wherein said cell binding agent and said cytotoxic agent are covalently linked.
27 . The cytotoxic conjugate according to claim 25 , wherein said cell binding agent and said cytotoxic agent are covalently linked through a PEG linking group.
28 . The cytotoxic conjugate according to claim 25 , wherein said cell binding agent and said cytotoxic agent are covalently linked through a thiol or disulfide functionality of said cytotoxic agent.
29 . The cytotoxic conjugate according to claim 25 , wherein said cell binding agent is a member selected from the group consisting of a polyclonal antibody, a monoclonal antibody, a fragment of an antibody, a humanized or resurfaced antibody, a functional equivalent of an antibody, an improved antibody, an interferon, a lymphokine, a hormone, a growth factor, transferrin and a vitamin.
30 . The cytotoxic conjugate according to claim 29 , wherein said fragment of an antibody is selected from the group consisting of a Fab fragment, a Fab′ fragment, a F(ab′) 2 fragment, a Fd fragment, a single-chain Fvs (scFv) fragment, a single-chain antibody, a disulfide-linked Fvs (sdFv) fragment and a fragment comprising either a VL or VH domain.
31 . The cytotoxic conjugate according to claim 25 , wherein said cell binding agent is an anti-CA6 monoclonal antibody or an epitope-binding fragment thereof.
32 . The cytotoxic conjugate according to claim 25 , wherein said cell binding agent is the murine anti-CA6 monoclonal antibody DS6 or an epitope-binding fragment thereof.
33 . The cytotoxic conjugate according to claim 25 , wherein said cell binding agent is a humanized version of the murine anti-CA6 monoclonal antibody DS6 or an epitope-binding fragment thereof.
34 . The cytotoxic conjugate according to claim 25 , wherein said cytotoxic agent is member selected from the group consisting of a maytansinoid compound, a taxoid compound, a CC-1065 compound, a dolastatin compound, a daunorubicin compound, and a doxorubicin compound.
35 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is the maytansine DM1 of formula (I):
36 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is the maytansine DM4 of formula (II):
37 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is a maytansine formula (III):
wherein:
Y′ represents (CR 7 CR 8 ) l (CR 9 ═CR 10 ) p C═C q A r (CR 5 CR 6 ) m D u (CR 11 ═CR 12 ) r (C═C) s B t (CR 3 CR 4 ) n CR 1 R 2 SZ,
wherein:
R 1 and R 2 are each independently CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H;
A, B, D are cycloalkyl or cycloalkenyl having 3-10 carbon atoms, simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical;
R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 11 , and R 12 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical;
l, m, n, o, p, q, r, s, and t are each independently 0 or an integer of from 1 to 5, provided that at least two of l, m, n, o, p, q, r, s and t are not zero at any one time; and
Z is H, SR or —COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical.
38 . The cytotoxic conjugate according to claim 37 , wherein R 1 is H, R 2 is methyl and Z is H.
39 . The cytotoxic conjugate according to claim 37 , wherein R 1 and R 2 are methyl and Z is H.
40 . The cytotoxic conjugate according to claim 37 , wherein R 1 is H, R 2 is methyl, and Z is —SCH 3 .
41 . The cytotoxic conjugate according to claim 37 , wherein R 1 and R 2 are methyl, and Z is —SCH 3 .
42 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is a maytansine selected from the group consisting of formulas (IV-L), (IV-D), and (IV-D,L):
wherein:
Y represents (CR 7 CR 8 ) l (CR 5 CR 6 ) m (CR 3 CR 4 ) n CR 1 R 2 SZ,
wherein:
R 1 and R 2 are each independently CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H;
R 3 , R 4 , R 5 , R 6 , R 7 and R 8 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical;
l, m and n are each independently an integer of from 1 to 5, and in addition n can be 0;
Z is H, SR or —COR wherein R is linear or branched alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical; and
May represents a maytansinoid which bears the side chain at C-3, C-14 hydroxymethyl, C-15 hydroxy or C-20 desmethyl.
43 . The cytotoxic conjugate according to claim 42 , wherein R 1 is H, R 2 is methyl, R 5 , R 6 , R 7 , and R 8 are each H, l and m are each 1, n is 0, and Z is H.
44 . The cytotoxic conjugate according to claim 42 , wherein R 1 and R 2 are methyl, R 5 , R 6 , R 7 , R 8 are each H, l and m are 1, n is 0, and Z is H.
45 . The cytotoxic conjugate according to claim 42 , wherein R 1 is H, R 2 is methyl, R 5 , R 6 , R 7 , and R 8 are each H, l and m are each 1, n is 0, and Z is —SCH 3 .
46 . The cytotoxic conjugate according to claim 42 , wherein R 1 and R 2 are methyl, R 5 , R 6 , R 7 , R 8 are each H, l and m are 1, n is 0, and Z is —SCH 3 .
47 . The cytotoxic conjugate according to claim 42 , wherein the cytotoxic agent is represented by formula (IV-L).
48 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is a maytansine formula (V):
wherein:
Y represents (CR 7 CR 8 ) l (CR 5 CR 6 ) m (CR 3 CR 4 ) n CR 1 R 2 SZ,
wherein:
R 1 and R 2 are each independently CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H;
R 3 , R 4 , R 5 , R 6 , R 7 and R 8 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical;
l, m and n are each independently an integer of from 1 to 5, and in addition n can be 0; and
Z is H, SR or —COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical.
49 . The cytotoxic conjugate according to claim 48 , wherein R1 is H, R2 is methyl, R5, R6, R7, and R8 are each H; l and m are each 1; n is 0; and Z is H.
50 . The cytotoxic conjugate according to claim 48 , wherein R 1 and R 2 are methyl; R 5 , R 6 , R 7 , R 8 are each H, l and m are 1; n is 0; and Z is H.
51 . The cytotoxic conjugate according to claim 48 , wherein R 1 is H, R 2 is methyl, R 5 , R 6 , R 7 , and R 8 are each H, l and m are each 1, n is 0, and Z is —SCH 3 .
52 . The cytotoxic conjugate according to claim 48 , wherein R 1 and R 2 are methyl, R 5 , R 6 , R 7 , R 8 are each H, l and m are 1, n is 0, and Z is —SCH 3 .
53 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is a maytansine selected from the group consisting of formulas (VI-L), (VI-D), and (VI-D,L):
wherein:
Y 2 represents (CR 7 CR 8 ) l (CR 5 CR 6 ) m (CR 3 CR 4 ) n CR 1 R 2 SZ 2 ,
wherein:
R 1 and R 2 are each independently CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H;
R 3 , R 4 , R 5 , R 6 , R 7 and R 8 are each independently H, CH 3 , C 2 H 5 , linear cyclic alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical;
l, m and n are each independently an integer of from 1 to 5, and in addition n can be 0;
Z 2 is SR or COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical; and
May is a maytansinoid.
54 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is a maytansine of formula (VII):
wherein:
Y 2 ′ represents (CR 7 CR 8 ) l (CR 9 ═CR 10 ) p (C═C) q A r (CR 5 CR 6 ) m D u (CR 11 ═CR 12 ) r (C═C) s B t (CR 3 CR 4 ) n CR 1 R 2 SZ 2 ,
wherein:
R 1 and R 2 are each independently CH 3 , C 2 H 5 , linear branched or alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H;
A, B, and D each independently is cycloalkyl or cycloalkenyl having 3 to 10 carbon atoms, simple or substituted aryl, or heterocyclic aromatic or heterocycloalkyl radical;
R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 11 , and R 12 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical;
l, m, n, o, p, q, r, s, and t are each independently 0 or an integer of from 1 to 5, provided that at least two of l, m, n, o, p, q, r, s and t are not zero at any one time; and
Z 2 is SR or —COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3-10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical.
55 . The cytotoxic conjugate according to claim 54 , wherein R1 is H and R2 is methyl.
56 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is a maytansine of formula (VIII):
wherein:
Y 1 ′ represents (CR 7 CR 8 ) l (CR 9 ═CR 10 ) p (C═C) q A r (CR 5 CR 6 ) m D u (CR 11 ═CR 12 ) r (C═C) s B t (CR 3 CR 4 ) n CR 1 R 2 S—,
wherein:
A, B, and D, each independently is cycloalkyl or cycloalkenyl having 3-10 carbon atoms, simple or substituted aryl, or heterocyclic aromatic or heterocycloalkyl radical;
R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 11 , and R 12 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical; and
l, m, n, o, p, q, r, s, and t are each independently 0 or an integer of from 1 to 5, provided that at least two of l, m, n, o, p, q, r, s and t are non-not zero at any one time.
57 . The cytotoxic conjugate according to claim 56 , wherein R 1 is H and R 2 is methyl.
58 . The cytotoxic conjugate according to claim 56 , wherein R 1 and R 2 are methyl.
59 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is a maytansine selected from the group consisting of formulas (IX-L), (IX-D), and (IX-D,L):
wherein:
Y 1 represents (CR 7 CR 8 ) l (CR 5 CR 6 ) m (CR 3 CR 4 ) n CR 1 R 2 S—,
wherein:
R 1 and R 2 are each independently CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H;
R 3 , R 4 , R 5 , R 6 , R 7 and R 8 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical;
l, m and n are each independently an integer of from 1 to 5, and in addition n can be 0; and
May represents a maytansinol which bears the side chain at C-3, C-14 hydroxymethyl, C-15 hydroxy or C-20 desmethyl.
60 . The cytotoxic conjugate according to claim 59 , wherein R 1 is H and R 2 is methyl or R 1 and R 2 are methyl.
61 . The cytotoxic conjugate according to claim 59 , wherein R 1 is H, R 2 is methyl, R 5 , R 6 , R 7 and R 8 are each H; l and m are each 1; n is 0.
62 . The cytotoxic conjugate according to claim 59 , wherein R 1 and R 2 are methyl; R 5 , R 6 , R 7 and R 8 are each H; l and m are 1; n is 0.
63 . The cytotoxic conjugate according to claim 60 , wherein the maytansinoid is represented by formula (IX-L).
64 . The cytotoxic conjugate according to claim 61 , wherein the maytansinoid is represented by formula (IX-L).
65 . The cytotoxic conjugate according to claim 62 , wherein the maytansinoid is represented by formula (IX-L).
66 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is a maytansine of formula (X):
wherein:
Y 1 represents (CR 7 CR 8 ) l (CR 5 CR 6 ) m (CR 3 CR 4 ) n CR 1 R 2 S—,
wherein:
R 1 and R 2 are each independently CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H;
R 3 , R 4 , R 5 , R 6 , R 7 and R 8 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical;
l, m and n are each independently an integer of from 1 to 5, and in addition n can be 0; and
May represents a maytansinol which bears the side chain at C-3, C-14 hydroxymethyl, C-15 hydroxy or C-20 desmethyl.
67 . The cytotoxic conjugate according to claim 66 , wherein R 1 is H, R 2 is methyl, R 5 , R 6 , R 7 and R 8 are each H, l and m are each 1, and n is 0.
68 . The cytotoxic conjugate according to claim 66 , wherein R 1 and R 2 are methyl; R 5 , R 6 , R 7 and R 8 are each H; l and m are 1; and n is 0.
69 . The cytotoxic conjugate according to claim 25 , wherein said cell binding agent is a humanized version of the murine anti-CA6 monoclonal antibody DS6 or an epitope-binding fragment thereof and wherein said cytotoxic agent is DM1 or DM4.
70 . The cytotoxic conjugate according to claim 34 , wherein said cytotoxic agent is the taxane formula (II):
71 . A method for inhibiting growth of a cell expressing CA6 glycotope, comprising contacting a cell expressing CA6 glycotope with the cytotoxic conjugate according to claim 25 .
72 . The method for inhibiting the growth of a cell expressing CA6 glycotope according to claim 71 , wherein the cytotoxic conjugate comprises an anti-CA6 monoclonal antibody or an epitope-binding fragment thereof as the cell binding agent and DM 1 or DM4 as the cytotoxic agent.
73 . The method for inhibiting the growth of a cell expressing CA6 glycotope according to claim 71 , wherein the cytotoxic conjugate comprises an anti-CA6 monoclonal antibody or an epitope-binding fragment thereof as the cell binding agent and a taxane as the cytotoxic agent.
74 . The method for inhibiting the growth of a cell expressing CA6 glycotope according to claim 71 , wherein the cytotoxic conjugate comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and DM1 or DM4 as the cytotoxic agent.
75 . The method for inhibiting the growth of a cell expressing CA6 glycotope according to claim 71 , wherein the cytotoxic conjugate comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and a taxane as the cytotoxic agent.
76 . The method for inhibiting the growth of a cell expressing CA6 glycotope according to claim 71 , wherein said inhibiting growth results in the death of the cell.
77 . The method for inhibiting the growth of a cell expressing CA6 glycotope according to claim 71 , wherein said method is performed in vivo, in vitro or ex vivo.
78 . A therapeutic composition, comprising a cytotoxic conjugate according to claim 25 and a pharmaceutically acceptable carrier or excipient.
79 . The therapeutic composition according to claim 78 , wherein the cytotoxic conjugate comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and DM1 or DM4 as the cytotoxic agent.
80 . The therapeutic composition according to claim 78 , wherein the cytotoxic conjugate comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and a taxane as the cytotoxic agent.
81 . A method of treating a subject having a cancer, said method comprising administering a therapeutically effective amount of the therapeutic composition according to claim 78 to a subject having a cancer, thereby treating a subject having a cancer.
82 . The method of treating a subject having a cancer according to claim 81 , wherein the cytotoxic conjugate comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and DM1 or DM4 as the cytotoxic agent.
83 . The method of treating a subject having a cancer according to claim 81 , wherein the cytotoxic conjugate comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and a taxane as the cytotoxic agent.
84 . The method of treating a subject having a cancer according to claim 81 , wherein the cancer is one in which CA6 glycotope is expressed or overexpressed.
85 . The method of treating a subject having a cancer according to claim 81 , wherein the cancer is selected from the group consisting of serous ovarian carcinoma, endometriod ovarian carcinoma, neoplasm of the uterine cervix, neoplasm of the endometrius, neoplasm of the vulva, breast carcinoma, pancreatic tumor, and tumor of the urothelium.
86 . A kit comprising a cytotoxic conjugate according to claim 25 , further comprising:
a) a compartment comprising the cytotoxic conjugate; and
b) instructions for use of the kit.
87 . The kit according to claim 86 , wherein said cytotoxic conjugate comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and DM1 or DM4 as the cytotoxic agent.
88 . The kit according to claim 86 , wherein said cytotoxic conjugate comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and a taxane as the cytotoxic agent.
89 . The kit according to claim 86 , wherein said instructions comprise instructions for treating a subject having a cancer.
90 . The kit according to claim 89 , wherein the cancer is one in which CA6 glycotope is expressed or overexpressed.
91 . The kit according to claim 90 , wherein the cancer is selected from the group consisting of serous ovarian carcinoma, endometriod ovarian carcinoma, neoplasm of the uterine cervix, neoplasm of the endometrius, neoplasm of the vulva, breast carcinoma, pancreatic tumor, and tumor of the urothelium.
92 . A kit comprising a therapeutic composition according to claim 78 , further comprising:
a) a compartment comprising the therapeutic composition; and
b) instructions for use of the kit.
93 . The kit according to claim 92 , wherein the cytotoxic conjugate of the therapeutic composition comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and DM1 or DM4 as the cytotoxic agent.
94 . The kit according to claim 92 , wherein the cytotoxic conjugate of the therapeutic composition comprises a humanized version of the murine antibody DS6 or an epitope-binding fragment thereof as the cell binding agent and a taxane as the cytotoxic agent.
95 . The kit according to claim 92 , wherein said instructions comprise instructions for treating a subject having a cancer.
96 . The kit according to claim 95 , wherein the cancer is one in which CA6 glycotope is expressed or overexpressed.
97 . The kit according to claim 96 , wherein the cancer is selected from the group consisting of serous ovarian carcinoma, endometriod ovarian carcinoma, neoplasm of the uterine cervix, neoplasm of the endometrius, neoplasm of the vulva, breast carcinoma, pancreatic tumor, and tumor of the urothelium.