IP Library Granted Patent US 7,648,962
Granted Patent B2
US 7,648,962 · App. 10/999,761 · Granted Jan 19, 2010

Natriuretic compounds, conjugates, and uses thereof

View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 7,648,962
App. No.
10/999,761
Granted
Jan 19, 2010
Kind
B2
Abstract

Modified natriuretic compounds and conjugates thereof are disclosed in the present invention. In particular, conjugated forms of hBNP are provided that include at least one modifying moiety attached thereto. The modified natriuretic compound conjugates retain activity for stimulating cGMP production, binding to NPR-A receptor, and in some embodiments an improved half-life in circulation as compared to unmodified counterpart natriuretic compounds. Oral, parenteral, enteral, subcutaneous, pulmonary, and intravenous forms of the compounds and conjugates may be prepared as treatments and/or therapies for heart conditions particularly congestive heart failure. Modifying moieties comprising oligomeric structures having a variety of lengths and configurations are also disclosed. Analogs of the natriuretic compound are also disclosed, having an amino acid sequence that is other than the native sequence.

Claims (124)

1. A natriuretic compound conjugate comprising:

(a) a biologically active natriuretic compound wherein the natriuretic compound comprises a brain natriuretic peptide (BNP) or a biologically active peptide segment of BNP that exhibits NPR-A receptor binding activity, and comprises:

(i) a disulfide loop for binding to the NPR-A receptor; and

(ii) at least one modifying moiety conjugation site; and

(b) at least one modifying moiety attached to said modifying moiety conjugation site, wherein the modifying moiety conjugation site comprises a Lysine amino acid residue of BNP, wherein the modifying moiety comprises a polyalkylene glycol moiety “PAGn” moiety wherein the PAG moiety is a polyethylene glycol moiety and n is 1 to 8, and at least one of the following groups; a linking group “X” attached to the PAG moiety; an internal alkyl group “(—CH 2 —)o” wherein o is 4 to 10;

wherein the modifying moiety is a formula:

wherein PAG is described above

X′ is —O— or —N—; and

each o is described above wherein said natriuretic compound conjugate exhibits one or more advantages selected from the group consisting of increased resistance to enzymatic degradation relative to a corresponding unconjugated natriuretic compound, increased circulating half life, increased bioavailability, and prolonged duration of effect.

2. The natriuretic compound conjugate of claim 1 further defined as retaining a therapeutically significant percentage of cGMP stimulating activity relative to the corresponding unconjugated natriuretic compound wherein the therapeutically significant percentage of cGMP stimulating activity ranges from about 30 to about 90% activity.

3. The natriuretic compound conjugate of claim 1 further defined as more hydrophilic than a corresponding unconjugated natriuretic compound.

4. The natriuretic compound conjugate of claim 1 further defined as more amphiphilic than a corresponding unconjugated natriuretic compound.

5. The natriuretic compound conjugate of claim 1 further defined as more lipophilic than a corresponding unconjugated natriuretic compound.

6. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises a sequence:

A 1 PX 1 MVQGSGCFGRX 2 MDRISSSSGLGCX 3 VLR (SEQ ID NO. 132),

wherein

A 1 is an amino acid or series of amino acids native to a natriuretic peptide,

X 1 , X 2 and X 3 are independently selected from the group consisting of Lys, Arg and Gly, and at least one of X 1 , X 2 and X 3 is a Lys.

7. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises a brain natriuretic peptide of SEQ ID NO. 99.

8. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises:

a. an amino acid sequence

X 1 —C 1 FGRX 2 MDRISSSSGLGC 2 —X 3 (SEQ ID NO. 133),

wherein

X 1 is optionally present and when present is an amino acid sequence having from 1-10 amino acids;

X 2 is Gly, Arg, or Lys; and

X 3 is optionally present and when present is an amino acid sequence having from 1-10 amino acids;

b. a disulfide bond between C 1 and C 2 to form a loop.

9. The natriuretic compound conjugate of claim 8 wherein X 1 is Arg or Gly.

10. The natriuretic compound conjugate of claim 8 wherein X 1 is selected from the group consisting of:

a. Lys;

b. Gly;

c. Arg;

d. SG-, GSG-, QGSG-(SEQ ID NO. 23), VQGSG-(SEQ ID NO. 24), MVQGSG-(SEQ ID NO. 25), PKMVQGSG-(SEQ ID NO. 27), and SPKMVQGSG-(SEQ ID NO. 28);

e. hBNP segments of d comprising a substitution selected from the group consisting of Lys-to-Gly and Lys-to-Arg;

f. hBNP segments of d comprising a substitution selected from the group consisting of Gly-to-Lys and Arg-to-Lys;

g. hBNP segments of d comprising an inserted Lys;

h. N-terminal tails and C-terminal segments of N-terminal tails of natriuretic peptides;

i. N-terminal tails and C-terminal segments of h comprising a substitution selected from the group consisting of Lys-to-Gly and Lys-to-Arg;

j. N-terminal tails and C-terminal segments of h comprising a substitution selected from the group consisting of Gly-to-Lys and Arg-to-Lys;

k. N-terminal tails and C-terminal segments of h comprising an inserted Lys.

11. The natriuretic compound conjugate of claim 8 wherein X 3 is selected from the group consisting of:

a. Lys;

b. Gly;

c. Arg;

d. hBNP segments Ky, KVL, KVLR (SEQ ID NO. 30), KVLRR (SEQ ID NO.31), and KVLRRH (SEQ ID NO. 32); and

e. hBNP segments of d comprising a substitution selected from the group consisting of Lys-to-Gly and Lys-to-Arg;

f. hBNP segments of d comprising a substitution selected from the group consisting of Gly-to-Lys and Arg-to-Lys;

g. hBNP segments of d comprising an inserted Lys;

h. C-terminal tails and N-terminal segments of C-terminal tails of natriuretic peptides;

i. C-terminal tails and N-terminal segments of C-terminal tails of h comprising a substitution selected from the group consisting of Lys-to-Gly and Lys-to-Arg;

j. C-terminal tails and N-terminal segments of C-terminal tails of h comprising a substitution selected from the group consisting of Gly-to-Lys and Arg-to-Lys;

k. C-terminal tails and N-terminal segments of C-terminal tails of h comprising an inserted Lys.

12. The natriuretic compound conjugate of claim 8 wherein the natriuretic compound comprises a sequence selected from the group consisting of:

a. SPKMVQGSGCCFGRKMDRISSSSGLGCKVL (SEQ ID NO. 134);

b. SPKMVQGSGCFGRKMDRISSSSGLGC (SEQ ID NO. 135); and

c. segments a or b comprising a substitution selected from the group consisting of Lys-to-Gly and Lys-to-Arg.

13. The natriuretic compound conjugate of claim 8 wherein X 1 comprises a 1-9 amino acid residue sequence from the N-terminus of hBNP.

14. The natriuretic compound conjugate of claim 8 wherein X 1 comprises SPX 3 MVQGSG (SEQ ID NO.6), and wherein X 2 comprises a modifying moiety conjugation site.

15. The natriuretic compound conjugate of claim 8 wherein X 3 comprises a 1-6 amino acid residue sequence from the C-terminus of hBNP.

16. The natriuretic compound conjugate of claim 8 wherein X 3 comprises KVLRRH (SEQ. ID. NO. 32), KVLRR (SEQ ID NO. 31), KVLR (SEQ ID NO. 30 ), KVL, KV or K.

17. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises a native hBNP sequence having one or more mutations selected from the group consisting of Lys3Arg, Lys14Arg, Arg30Lys, Lys27Arg, and Arg31Lys.

18. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises a native hBNP sequence, having one or more insertions or deletions.

19. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises a native hBNP amino acid sequence and a N-terminal or C-terminal Lys.

20. The natriuretic compound conjugate of claim 1 further defined as:

a. comprising a multipeptide comprising two or more amino acid sequences encoding a natriuretic compound;

b. optionally comprising a spacer sequence between each set or adjacent natriuretic compound encoding sequences;

c. optionally comprising an extension at either or both ends of the multipeptide, the extension comprising one or more amino acids.

21. The natriuretic compound conjugate of claim 20 wherein the at least one modifying moiety conjugation site is a Lys.

22. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound consists of a native BNP.

23. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound consists of a native hBNP.

24. The natriuretic compound conjugate of claim 1 wherein the internal amino acid residue is Lys3, Lys 14 or Lys 28.

25. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound consists of a canine BNP.

26. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound consists of urodilatin.

27. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound consists of DNP.

28. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises the amino acid sequence Des His32, Des Arg31 hBNP.

29. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises an amino acid sequence:

X 1 MVQGSGCFGRX 2 MDRISSSSGLGCX 3 (SEQ ID NO. 136),

wherein X 1 , X 2 and X 3 are each independently selected from the group consisting of Lys, Gly and Arg, with the proviso that at least one of X 1 , X 2 and X 3 is Arg or Gly.

30. The natriuretic compound conjugate of claim 29 wherein the sequence comprises:

a. N-terminal to X 1 , an extension selected from the group consisting of: SPK, PK and K; and/or

b. C-terminal to X 3 , an extension selected from the group consisting of -VLRRH (SEQ ID NO. 19), -VLRR (SEQ ID NO. 20), -VLR, -VL, and -V.

31. The natriuretic compound conjugate of claim 29 wherein X 1 is Lys, X 2 is Arg and X 3 is Arg.

32. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises an amino acid sequence:

CFGRX 1 MDRISSSSGLGCX 2 (SEQ ID NO. 21),

wherein X 1 and/or X 2 comprises a modifying moiety conjugation site coupled to the modifying moiety.

33. The natriuretic compound conjugate of claim 32 wherein X 1 comprises Lys coupled to the modifying moiety.

34. The natriuretic compound conjugate of claim 32 wherein X 2 comprises Lys coupled to the modifying moiety.

35. The natriuretic compound conjugate of claim 1 wherein the modifying moiety conjugation site comprises a moiety selected from the group consisting of an N-terminus of the natriuretic compound, and a C-terminus of the natriuretic compound.

36. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound conjugate includes only one modifying moiety.

37. The natriuretic compound conjugate of claim 1 wherein:

a. the natriuretic compound comprises a Lys 3 to Cys 26 segment of hBNP and a disulfide bond coupling Cys 10 of the segment to the Cys 26 ;

b. a single modifying moiety coupled to the natriuretic compound at the Lys 3 .

38. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises a Cys 10 to Cys 26 segment of hBNP and a disulfide bond coupling the Cys 10 to the Cys 26 , wherein said natriuretic compound is a monoconjugate including a single modifying moiety coupled thereto at Lys 14 of the segment.

39. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises a Cys 10 to Lys 27 segment of hBNP, wherein said natriuretic compound is a monoconjugate including a single modifying moiety coupled thereto at Lys 27 of the segment.

40. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound comprises a Cys 10 to His 32 segment of hBNP and a disulfide bond coupling the Cys 10 to Cys 26 of the segment, wherein said natriuretic compound is a monoconjugate including a single modifying moiety coupled thereto at Lys 27 of the segment.

41. The natriuretic compound conjugate of claim 1 wherein:

a. the natriuretic compound consists of the hBNP amino acid sequence; and

b. the natriuretic compound conjugate is a diconjugate comprising:

i. a modifying moiety coupled to the natriuretic peptide at Lys 3 of the hBNP amino acid sequence; and

ii. a modifying moiety coupled to the natriuretic peptide at Lys 14 of the hBNP amino acid sequence.

42. The natriuretic compound conjugate of claim 1 wherein:

a. the natriuretic compound is hBNP; and

b. the natriuretic compound conjugate is a diconjugate comprising:

i. a modifying moiety coupled to the natriuretic peptide at Lys 3 of the hBNP amino acid sequence; and

ii. a modifying moiety coupled to the natriuretic peptide at Lys27 of the hBNP amino acid sequence.

43. The natriuretic compound conjugate of claim 1 wherein the natriuretic compound sequence comprises an N-terminal tail and the modifying moiety is coupled to an amino acid which is positioned in the N-terminal tail.

44. The natriuretic compound conjugate of claim 43 wherein the N-terminal tail consists of a native sequence of an N-terminal tail of a natriuretic peptide or a C-terminal segment of an N-terminal tail of a natriuretic peptide.

45. The natriuretic compound conjugate of claim 1 wherein the modifying moiety is coupled to the natriuretic compound by a bond that is hydrolysable in vivo.

46. The natriuretic compound conjugate of claim 1 wherein the modifying moiety is coupled to the natriuretic compound by a bond that is hydrolysable in the bloodstream.

47. The natriuretic compound conjugate of claim 1 wherein the modifying moiety is coupled to the natriuretic compound by a bond that is not hydrolysable in vivo.

48. The natriuretic compound conjugate of claim 1 wherein the modifying moiety is coupled to the natriuretic compound by a bond that is not hydrolysable in the bloodstream.

49. The natriuretic compound conjugate of claim 1 wherein the modifying moiety is coupled to the natriuretic compound by a bond selected from the group consisting of ester, carbonate, carbamate, amide, ether, and amine.

50. The natriuretic compound conjugate of claim 1 wherein the modifying moiety is hydrolysable in vivo to yield a PAGylated natriuretic compound.

51. The natriuretic compound conjugate of claim 1 wherein the modifying moiety is hydrolysable in vivo to yield a PAGylated natriuretic compound comprising one or more PAG moieties having 1, 2, 3, 4, 5, or 6 PAG units.

52. A pharmaceutical formulation comprising the natriuretic compound conjugate of claim 1 .

53. The pharmaceutical formulation of claim 52 formulated for a route of delivery selected from the group consisting of enteral, parenteral, oral, subcutaneous, sublingual, buccal, nasal, pulmonary, intravenous and intramuscular.

54. A method of treating a condition characterized by an excessive level of extracellular fluid, the method comprising administering to a subject in need thereof a pharmaceutically acceptable amount of the BNP natriuretic compound conjugate of claim 1 .

55. The method of claim 54 wherein the condition comprises congestive heart failure.

56. The method of claim 54 wherein the condition comprises chronic congestive heart failure.

57. The method of claim 54 wherein the condition comprises acute congestive heart failure.

58. The method of claim 54 wherein the natriuretic compound conjugate is self administered.

59. The method of claim 54 wherein the natriuretic compound conjugate is orally administered.

60. The method of claim 54 wherein the natriuretic compound conjugate is administered via a route of administration selected from the group consisting of enteral, parenteral, oral, subcutaneous, sublingual, buccal, nasal, pulmonary, intravenous and intramuscular.

61. The method of claim 54 wherein the condition is hypertension.

Assignments (3)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded May 2, 2006
From: NOBEX CORPORATION
To: BIOCON LIMITED
Reel/Frame 017555/0904 →
SECURITY AGREEMENT Recorded Mar 9, 2006
From: NOBEX CORPORATION
To: BIOCON LIMITED
Reel/Frame 017649/0280 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Mar 18, 2005
From: JAMES, KENNETH D.; RADHAKRISHNAN, BALASINGHAM; MALKAR, NAVDEEP B.; MILLER, MARK A.
To: NOBEX CORPORATION
Reel/Frame 015793/0704 →