IP Library Granted Patent US 7,803,524
Granted Patent B2
US 7,803,524 · App. 11/084,858 · Granted Sep 28, 2010

Antigenic HIV gp41 chimeric polypeptides comprising the MVP5180/91 epitope SKGKLIS

View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 7,803,524
App. No.
11/084,858
Granted
Sep 28, 2010
Kind
B2
Abstract

Immunologically active peptides which are derived from a novel immunodeficiency virus which has the designation MVP5180/91 are described. A diagnostic composition containing such a peptide and methods of detecting an antibody against a retrovirus that causes immune deficiency using such diagnostic composition are also described. A kit containing the immunologically active peptides is also described. An immunogen and method of immunizing a mammal against HIV infection using the immunologically active peptides is described. DNA encoding the peptides and methods of detecting nucleic acids encoding HIV viruses are also described.

Claims (20)

1. An isolated immunologically active human immunodeficiency virus (HIV) chimeric polypeptide comprising the following:

(a) at least 15 consecutive amino acids of SEQ ID NO.: 1 comprising the epitope XKGKLIX (amino acid residues 29-35 of SEQ ID NO.: 1) wherein X is S, and

(b) one or more additional non-MVP5180/91 HIV-1 or HIV-2 amino acids at the amino-terminus and/or carboxyl-terminus,

wherein said polypeptide is capable of binding to HIV-1-specific antibodies.

2. The polypeptide of claim 1 , wherein said amino acid sequences are selected from a fragment of VWGIRQLRARLQALETLIQNQQRLNLWGSKGKLISYTSVKWNTSWSGR (SEQ ID NO.: 1).

3. An isolated immunologically active human immunodeficiency virus type 1 (HIV-1) MVP5180/91 polypeptide comprising the amino acid sequence RLQALETLIQNQQRLNLWGSKGKLIS (SEQ ID NO.: 4).

4. An isolated immunologically active human immunodeficiency virus type 1 (HIV-1) MVP5180/91 polypeptide comprising the amino acid sequence VWGIRQLRARLQALETLIQNQQRLNLWGSKGKLISYTSVKWNTSWSGR (SEQ ID NO.: 1).

5. A diagnostic composition for detecting antibodies that bind to human immunodeficiency viruses (HIVs) in a biological sample, the diagnostic composition comprising the polypeptide of claim 1 , wherein said polypeptide is conjugated to a detectable label.

6. A diagnostic composition for detecting antibodies that bind to human immunodeficiency viruses (HIVs) in a biological sample, the diagnostic composition comprising the polypeptide of claim 1 and a secondary detection reagent that is conjugated to a detectable label.

7. The diagnostic composition of claim 5 or claim 6 , wherein the detectable label is chosen from radioisotopes, enzymes, fluorescent labels, antibody conjugates, and substrates.

8. A diagnostic kit for detecting antibodies that bind to human immunodeficiency viruses (HIVs) in a biological sample, the diagnostic kit comprising a container that contains the polypeptide of claim 1 .

9. The kit of claim 8 further comprising at least one control antibody contained in one or more containers, wherein the control antibody has a known binding affinity for the polypeptide.

10. The kit of claim 9 further comprising written instructions for using said kit.

11. A method of detecting antibodies that bind to human immunodeficiency viruses (HIVs) in a biological sample, the method comprising:

(a) obtaining the biological sample;

(b) contacting the sample with the diagnostic composition of claim 5 or claim 6 under conditions to promote the formation of antibody/polypeptide complexes;

(c) rinsing the antibody/polypeptide complexes of step (b) to remove unbound antibodies and/or unbound polypeptides; and

(d) detecting the presence of antibody/polypeptide complexes as a result of said contacting.

12. The method of claim 11 , wherein the biological sample is chosen from blood, urine, saliva, spinal fluid, semen, peritoneal fluid, organ tissue, muscle tissue, and skin.

13. The method of claim 11 , wherein the detectable label present in the diagnostic composition is chosen from radioisotopes, enzymes, fluorescent labels, antibody conjugates, and substrates.

Assignments (1)
CHANGE OF NAME Recorded Feb 26, 2009
From: DADE BEHRING MARBURG GMBH
To: SIEMENS HEALTHCARE DIAGNOSTICS PRODUCTS GMBH
Reel/Frame 022309/0627 →