IP Library Granted Patent US 7,749,772
Granted Patent B1
US 7,749,772 · App. 11/478,972 · Granted Jul 6, 2010

Antibody and immunoassays for determining the presence of Δ

View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 7,749,772
App. No.
11/478,972
Granted
Jul 6, 2010
Kind
B1
Abstract

Antibodies having specific binding for the parent THC (Δ 9 -THC) and its major metabolites are provided which present a significant increase in sensitivity of immunoassays such as lateral flow immunoassays and ELISA for THC. The present invention also provides a rabbit hybridoma producing the antibody as a monoclonal antibody, a recombinant antibody, further molecularly engineered recombinant antibodies against parent Δ 9 -THC and its metabolites and cell lines producing the recombinant antibodies. The invention also provides applications of the antibody in immunoassays, particularly lateral flow immunoassays, specifically applications in detecting THC in body fluids, particularly saliva, and kits for determining the presence of THC.

Claims (19)

1. An isolated antibody having specific binding for THC and its metabolites, wherein said antibody comprises CDR amino acid sequences as follows: L1: QASQSVYNNNQLS (SEQ ID NO:1); L2: GTSNLAS (SEQ ID NO:2); L3: QGGYTSGDGIA (SEQ ID NO:3); H1: GFSLSNYVLA (SEQ ID NO:4); H2: TIVSGTTYYASW (SEQ ID NO:5); H3: GLPHYITGDI (SEQ ID NO:6); or homologous amino acid sequences having at least 85% homology thereto.

2. The antibody of claim 1 , wherein the amino acid sequence for the light chain variable region comprises the sequence: QVLTQTPSPVSAAVGGTVTINCQASQSVYNNNQLSWYQQKPGQPPKLLIYGTSNLAS GVPSRFKGSGSGTQFTLTISSVQCDDAATYYCQGGYTSGDGIAFGGGTEVVVK (SEQ ID NO:7), or homologous amino acid sequences having at least 85% homology thereto.

3. The antibody of claim 1 , wherein the amino acid sequence for the heavy chain variable region comprises the sequence: QSVEESGGRLVTPGTPLTLTCTVSGFSLSNYVLAWVRQAPGKGLEWIGTIVSGTTYY ASWAKGRFTISKTSTTVHLKITSPTTEDTATYFCVRGLPHYITGDIWGPGTLVTVSLG (SEQ ID NO:8), or homologous amino acid sequences having at least 85% homology thereto.

4. The antibody of claim 1 , wherein the antibody is a monoclonal antibody.

5. The monoclonal antibody of claim 4 , wherein the antibody is produced by recombinant methods or by a hybridoma.

6. The monoclonal antibody of claim 4 , wherein the antibody is a rabbit antibody.

7. A host cell expressing the antibody of claim 1 .

8. The host cell of claim 7 , wherein the host cell is a HEK 293 cell.

9. An immunoassay for detecting the presence of THC and its metabolites in a sample, comprising

contacting the sample with the antibody of claim 1 , such that immune complexes form between the antibody and THC or its metabolites;

detecting and relating the binding of the antibody to the THC or its metabolites to the presence of said THC or its metabolites in the sample.

10. The immunoassay of claim 9 , wherein the antibody is labeled or conjugated to particles.

11. A lateral flow immunoassay strip for detecting the presence of THC and/or its metabolites in a fluid sample, comprising a membrane strip coated with a THC-protein conjugate on a test line, and particles coated with the antibody of claim 1 .

12. A method for detecting the presence of THC in a sample, comprising the steps of

(1) providing the lateral flow immunoassay strip of claim 11 ;

(2) contacting said lateral flow immunoassay strip with a sample to be tested for the presence of Δ 9 -THC in the sample;

(3) allowing the sample to migrate along the strip;

(4) determining whether the immunoassay is positive or negative for the presence of Δ 9 -THC in the sample by detecting the presence or absence of the antibody-coated particles in the test line region of the lateral flow immunoassay strip.

13. A kit for testing for the presence of THC in saliva, comprising the lateral flow immunoassay strip for THC of claim 11 , and instructions for performing the test.