GIP analog and hybrid polypeptides with selectable properties
View Patent ↗The present invention relates generally to novel GIP analogs and GIP hybrid polypeptides with selectable properties, useful as agents for the treatment and prevention of metabolic diseases and disorders, for example those which can be alleviated by control plasma glucose levels, insulin levels, and/or insulin secretion, positive inotropic effects, reduction of catabolic effects, slowing of gastric emptying. Such conditions and disorders include, but are not limited to, hypertension, dyslipidemia, cardiovascular disease, eating disorders, critical care, insulin-resistance, obesity, and diabetes mellitus of any kind, including type 1, type 2, and gestational diabetes.
1. A gastric inhibitory peptide (GIP) hybrid polypeptide exhibiting at least two hormonal activities, said hybrid polypeptide comprising a first bio-active peptide hormone covalently linked to at least one additional bio-active peptide hormone; wherein:
the first bio-active peptide hormone is a GIP, a bio-active fragment of the GIP of at least 21 amino acids that exhibits at least one hormonal activity of the GIP, a bio-active analog of the GIP that exhibits at least one hormonal activity of the GIP or a bio-active derivative with a water soluble polymer thereof that exhibits at least one hormonal activity of the GIP, GIP analog or GIP fragment;
the at least one additional bio-active peptide is an amylin, a bio-active fragment of the amylin that exhibits at least one hormonal activity of the amylin, a bio-active analog of the amylin that exhibits at least one hormonal activity of the amylin or a bio-active derivative with a water soluble polymer thereof that exhibits at least one hormonal activity of the amylin, amylin analog or amylin fragment;
and each of the bio-active peptide hormones exhibits at least one hormonal activity of its parent peptide hormone.
2. The hybrid polypeptide of claim 1 , wherein at least one of the first bio-active peptide hormone or the at least one additional bio-active peptide hormone is a peptide hormone or fragment of the peptide hormone of at least 21 amino acids that exhibits at least one hormonal activity of the peptide hormone.
3. The hybrid polypeptide of claim 1 , wherein at least one of the first bio-active peptide hormone or the at least one additional bio-active peptide hormone is an analog or derivative of the peptide hormone with a water soluble polymer that exhibits at least one hormonal activity or a fragment of an analog or derivative of the peptide hormone that exhibits at least one hormonal activity of the peptide hormone.
4. The hybrid polypeptide of claim 1 , wherein the first bio-active peptide hormone that exhibits at least one hormonal activity is located at the N-terminal portion of the hybrid polypeptide.
5. The hybrid polypeptide of claim 1 , wherein the at least one additional bio-active peptide hormone that exhibits at least one hormonal activity is located at the C-terminal portion of the hybrid polypeptide.
6. The hybrid polypeptide of claim 5 , wherein the C-terminal end of the hybrid polypeptide is amidated or acylated.
7. The hybrid polypeptide of claim 1 , wherein the C-terminal end of the first bio-active peptide hormone is directly attached to the N-terminal end of the at least one additional bio-active peptide hormone to form the covalent attachment.
8. The hybrid polypeptide of claim 1 , wherein the bio-active peptide hormones are covalently attached using one or more linking groups independently selected from the group consisting of: alkyls; dicarboxylic acids PEGs; amino acids; polyaminoacids; bifunctional linkers; aminocaproyl (Aca); Gly; beta-alanyl; 8-amino-3,6-dioxaoctanoyl; and Gly-Lys-Arg (GKR).
9. The GIP hybrid of claim 1 wherein the first bioactive peptide comprises a GIP peptide selected from FIGS. 12A-UU .
10. The hybrid of claim 1 wherein the first bio-active peptide comprises YAEGTFISDYSIAMDKIHQQDFVMWLLAQK (SEQ ID NO: 311) where the second amino acid is D-alanine.
11. The hybrid of claim 1 wherein the additional bio-active amylin peptide comprises amylin analog KCNTATCVLGRLSQELHRLQTYPRTNTGSNTY (SEQ ID NO: 95).
12. The hybrid of claim 1 wherein the hybrid comprises the structure YaEGTFISDYSIAMDKIHQQDFVMWLLAQK-bAla-bAla-KCNTATCVLGRLSQELHRLQTYPRTNTGSNTY-NH2.