IP Library Patent Application 12122627
Patent Application
App. No. 12/122,627

CYSTEIC ACID DERIVATIVES OF ANTI-VIRAL PEPTIDES

Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US None
App. No.
12/122,627
Abstract

This invention relates to C34 peptide derivatives having improved aqueous solubility that are inhibitors of viral infection and/or exhibit antifusogenic properties. In particular, this invention relates to C34 derivatives having inhibiting activity against human immunodeficiency virus (HIV), respiratory synctial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV), and simian immunodeficiency virus (SIV) with long duration of action for the treatment of the respective viral infections.

Claims (68)

1 . A modified anti-fusogenic peptide, or a conjugate thereof, wherein the peptide is modified to have increased solubility in aqueous solution at a pH ranging from about 5 to 8, compared to the peptide prior to modification, and wherein the modified peptide has the following properties:

a) shows less than about 10% precipitation in the aqueous solution at a concentration in the range of about 10 to 180 mg/ml;

b) has a solubility limit that is at least about 2.5-fold higher than the peptide prior to modification; and

c) has a solubility limit of at least about 20 mg/ml in the aqueous solution.

2 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 1 , wherein the modified peptide comprises one or more polar moieties that are either charged or uncharged at physiological pH.

3 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 2 , wherein the one or more polar moieties of the modified peptide comprise one or more polar or neutral side chain not found in the twenty naturally occurring amino acids.

4 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 3 , wherein the one or more polar moieties of the modified peptide comprise one or more cysteic acids.

5 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 1 or 4 , the one or more cysteic acids of the modified peptide are added to the N-terminal or C-terminal end of the modified anti-fusogenic peptide.

6 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 3 , wherein the one or more polar moieties of the modified peptide do not substantially affect the secondary or tertiary structure of the peptide.

7 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 1 or 4 , wherein the modified peptide comprises at least a portion of a gp41 coiled-coil cavity binding residues.

8 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 7 , wherein the modified peptide comprises the amino acid sequence of C34 from amino acids 628 WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL 661 (SEQ ID NO:2), or up to two amino acid substitutions, insertions or deletions thereto.

9 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 7 , wherein the modified peptide comprises the amino acid sequence of DP107 and DP178, or up to two amino acid substitutions, insertions or deletions thereto.

10 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 7 , further comprising one or more chemically reactive moieties such that the modified peptides can react with available functionalities on blood components or carrier proteins to form stable covalent bonds of the conjugate.

11 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 10 , wherein the reactive moiety is a maleimide-containing group.

12 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 10 , further comprising one or more linkers selected from the group consisting of: (2-amino)ethoxy acetic acid (AEA), [2-(2-amino)ethoxy)]ethoxy acetic acid (AEEA), ethylenediamine (EDA); one or more alkyl chains (C1-C10) such as 8-aminooctanoic acid (AOA), 8-aminopropanoic acid (APA), and 4-aminobenzoic acid (APhA).

13 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 10 , wherein the reactive moiety, with or without linker, is added to the C-terminal of the modified peptide, and the one or more polar moieties are added to the N-terminal end of the modified anti-fusogenic peptide.

14 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 10 , wherein the reactive moiety, with or without linker, is added to the N-terminal of the modified peptide, and the one or more polar moieties are added to the C-terminal end of the modified anti-fusogenic peptide.

15 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 10 , wherein the blood component or carrier protein is albumin.

16 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 15 , wherein the albumin is recombinant.

17 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 16 , wherein the albumin is covalently linked.

18 . A modified anti-fusogenic peptide, or a conjugate thereof, having a configuration as follows:

[(cysteic acid)−MODIFIED PEPTIDE−Linker n −Reactive Group]; or

[Reactive Group−Linker n −MODIFIED PEPTIDE−(cysteic acid)].

wherein the reactive group is a maleimide-containing group covalently coupled to human serum albumin, with or without a linker;

n can be 0, 1, 2, 3, 4 or more linkers selected from the group consitisting of (2-amino)ethoxy acetic acid (AEA), [2-(2-amino)ethoxy)]ethoxy acetic acid (AEEA), ethylenediamine (EDA); one or more alkyl chains (C1-C10) such as 8-aminooctanoic acid (AOA), 8-aminopropanoic acid (APA), and 4-aminobenzoic acid (APhA); and

the modified peptide comprises the amino acid sequence of C34 from amino acids 628 WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL 661 (SEQ ID NO:2), or up to two amino acid substitutions or additions thereto.

19 . A modified anti-fusogenic peptide, or a conjugate thereof, having a formula as follows:

(R 1 ) m -X-(R 2 ) n   (I)

wherein in formula (I), the sum of m and n is at least 1 and m and n are each integers that are zero or greater;

X comprises the amino acid sequence of C34, DP107, DP178, or an analog thereof,

R 1 is present and R 2 is absent, R 1 is present at the N-terminus of the X group; and

When R 1 is absent and R 2 is present, R 2 is present at the C-terminus of the X group.

20 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 19 , wherein R 1 and R 2 are each independently selected from a compound having formula (II):

wherein the core structure of formula (II) is similar to that of an amino acid and includes an amino group, an alpha carbon and a carboxyl group; and

wherein the R 3 group of formula (II) comprises a sulfonyl group (HS═(O) 2 ), a sulfoxide group (HS═O), a sulfonic acid group (HO—S═(O) 2 ), a haloalkyl group, a secondary amine, a tertiary amine, a hydroxyl group, or other side chain group that is polar or even neutral and that can increase the overall solubility of the peptide derivative in an aqueous solution.

21 . The modified anti-fusogenic peptide, or conjugate thereof, of claim 20 , wherein the R 1 and R 2 groups do not substantially affect the overall secondary or the tertiary structure of the peptide. By not substantially affecting the secondary structure of the peptide conjugate, the overall activity of the peptide conjugate should not be appreciably less than that of the non-derivatized peptide.

22 . A modified anti-fusogenic peptide having the structure selected from the group consisting of:

CA Compound I: (Cysteic Acid (CA) directly linked to C34; also referred to herein as

CA-C34 (SEQ ID NO:3).

CA Compound II: (Cysteic Acid (CA) directly linked to C34 having a substitution of native Lysine at position 28 (Lys 28 ) for an arginine; also referred to herein as CA-C34 (Arg 28 ) (SEQ ID NO:4).

CA Compound III: (Cysteic Acid (CA) directly linked to C34 having an additional Lysine residue at position 35 (Lys 35 ), wherein the epsilon NH 2 group of lysine is coupled to the reactive group via linker (AEEA-MPA); also referred to herein as CA-C34-Lys 35 (ε-AEEA-MPA) (SEQ ID NO:5).

and

CA Compound IV: (Cysteic Acid (CA) directly linked to C34 having a substitution of native Lysine at position 28 (Lys 28 ) for an arginine; an additional Lysine residue at position 35 (Lys 35 ), wherein the epsilon NH 2 group of lysine is coupled to the reactive group via linker (AEEA-MPA); also referred to herein as CA-C34 (Arg 28 )-Lys 35 (ε-AEEA-MPA) (SEQ ID NO:6).

23 . A conjugate comprising the modified anti-fusogenic peptide of any of claims 1 , 4 , 18 , 19 , or 22 .

24 . A conjugate comprising the modified anti-fusogenic peptide of claim 8 coupled, with or without a linker, to one or more amino groups, hydroxyl groups, or thiol groups on albumin to form stable covalent bonds.

25 . A conjugate comprising the modified anti-fusogenic peptide of claim 10 coupled, with or without a linker, to one or more amino groups, hydroxyl groups, or thiol groups on albumin to form stable covalent bonds.

26 . A conjugate comprising the modified anti-fusogenic peptide of claim 11 coupled, with or without a linker, to one or more amino groups, hydroxyl groups, or thiol groups on albumin to form stable covalent bonds.

27 . A conjugate comprising the modified anti-fusogenic peptide of claim 12 coupled, with or without a linker, to one or more amino groups, hydroxyl groups, or thiol groups on albumin to form stable covalent bonds.

28 . A conjugate comprising the modified anti-fusogenic peptide of claim 13 coupled, with or without a linker, to one or more amino groups, hydroxyl groups, or thiol groups on albumin to form stable covalent bonds.

29 . A conjugate comprising the modified anti-fusogenic peptide of claim 15 coupled, with or without a linker, to one or more amino groups, hydroxyl groups, or thiol groups on albumin to form stable covalent bonds.

30 . A conjugate comprising the modified anti-fusogenic peptide of claim 22 coupled, with or without a linker, to one or more amino groups, hydroxyl groups, or thiol groups on albumin to form stable covalent bonds.

31 . A pharmaceutical composition comprising the modified anti-fusogenic peptide, or conjugate thereof, of claim 8 and a pharmaceutically acceptable carrier suitable for subcutaneous, intravenous or pulmonary administration.

32 . A pharmaceutical composition comprising the modified anti-fusogenic peptide, or conjugate thereof, of claim 22 and a pharmaceutically acceptable carrier suitable for subcutaneous, intravenous or pulmonary administration.

33 . A pharmaceutical composition comprising the conjugate of claim 23 and a pharmaceutically acceptable carrier suitable for subcutaneous, intravenous or pulmonary administration.

34 . A pharmaceutical composition comprising the conjugate of claim 24 and a pharmaceutically acceptable carrier suitable for subcutaneous, intravenous or pulmonary administration.

35 . A method of treating or preventing a virus selected from the group consisting of human immunodeficiency virus (HIV) infection, respiratory syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), measles virus (MeV) and simian immunodeficiency virus (SIV) in a subject, comprising

administering the modified anti-fusogenic peptide, or conjugate thereof, of claim 8 to the subject having, or at risk of having, the virus, thereby treating or preventing the infection

36 . A method of treating or preventing a virus selected from the group consisting of human immunodeficiency virus (HIV) infection, respiratory syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), measles virus (MeV) and simian immunodeficiency virus (SIV) in a subject, comprising

administering the modified anti-fusogenic peptide, or conjugate thereof, of claim 22 to the subject having, or at risk of having, the virus, thereby treating or preventing the infection

37 . A method of treating or preventing a virus selected from the group consisting of human immunodeficiency virus (HIV) infection, respiratory syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), measles virus (MeV) and simian immunodeficiency virus (SIV) in a subject, comprising

administering the conjugate of claim 23 to the subject having, or at risk of having, the virus, thereby treating or preventing the infection

38 . A method of treating or preventing a virus selected from the group consisting of human immunodeficiency virus (HIV) infection, respiratory syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), measles virus (MeV) and simian immunodeficiency virus (SIV) in a subject, comprising

administering conjugate of claim 24 to a subject having, or at risk of having, the virus, thereby treating or preventing the infection

39 . A methods for inhibiting one or more activities of human immunodeficiency virus (HIV) infection, respiratory syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), measles virus (MeV) and simian immunodeficiency virus (SIV) in a subject, comprising administering to the subject in need to treatment an effective amount of the modified anti-fusogenic peptide, or conjugate thereof, of claim 8 .

40 . A method for inhibiting one or more activities of human immunodeficiency virus (HIV) infection, respiratory syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), measles virus and simian immunodeficiency virus (SIV) in a subject, comprising administering to the subject in need to treatment an effective amount of the modified anti-fusogenic peptide, or conjugate thereof, of claim 22 .

41 . A method for enhancing the large-scale preparation of an anti-fusogenic peptide, comprising:

providing a modified anti-fusogenic peptide of claim 8 ; and

preparing a solution of the modified peptide that has a concentration of the modified peptide of at least 100 mg/ml.

Assignments (5)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Apr 13, 2011
From: ADVANCED DIAGNOSTICS AND DISCOVERY
To: CONJUCHEM, LLC
Reel/Frame 026122/0692 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Oct 26, 2010
From: CONJUCHEM BIOTECHNOLOGIES INC.
To: ADVANCED DIAGNOSTICS AND DISCOVERY
Reel/Frame 025198/0735 →
CHANGE OF NAME Recorded Dec 11, 2009
From: 4523482 CANADA INC.
To: CONJUCHEM BIOTECHNOLOGIES, INC.
Reel/Frame 023639/0162 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Dec 2, 2009
From: CONJUCHEM BIOTECHNOLOGIES INC.
To: 4523482 CANADA INC.
Reel/Frame 023594/0067 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Sep 9, 2008
From: QURAISHI, OMAR; ROBITAILLE, MARTIN; BRIDON, DOMINIQUE P.
To: CONJUCHEM BIOTECHNOLOGIES INC.
Reel/Frame 021500/0680 →