Skin wound healing compositions and methods of use thereof
A wound healing composition comprising a class of polypeptide compounds having a polypeptide chain with 5 to 120 amino acid units per chain. The composition includes a pharmaceutical medium to carry the polypeptide compound, such as an aqueous solution, suspension, dispersion, salve, ointment, gel, cream, lotion, spray or paste. Additionally, a method of applying a wound healing composition comprising a class of polypeptide compounds having a polypeptide chain with 5 to 120 amino acid units per chain in a concentration of from about 1 μg/ml to about 100 μg/ml for a time sufficient to heal the wound is disclosed.
1. A wound healing composition comprising:
a polypeptide compound having a polypeptide chain,
wherein the polypeptide chain consists of an amino acid sequence EEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEE (SEQ ID NO: 1).
2. A wound healing composition comprising:
a polypeptide compound having a polypeptide chain,
wherein the polypeptide chain consists of the amino acid sequence of human hsp90α peptide from amino acids 236 to 350.
3. A wound healing composition comprising:
a polypeptide compound having a polypeptide chain,
wherein the polypeptide chain consists of the amino acid sequence SDEEEEKKDGDKKKKKKIKEKYIDQEE (SEQ ID NO: 2).
4. The wound healing composition according to any of claims 1 to 3 , further comprising a pharmaceutical medium to carry the polypeptide compound, wherein the pharmaceutical medium is one selected from the group consisting of: an aqueous solution, suspension, dispersion, salve, ointment, gel, cream, lotion, spray or paste.