Modulators of MYC, methods of using the same, and methods of identifying agents that modulate MYC
View Patent ↗Disclosed herein are methods of modulation of the viability of a cell. Further disclosed herein are methods of modulating an immune response. Further disclosed herein are methods of identifying agents capable of modulation of the viability of a cell or an immune response. Further disclosed herein are agents and compositions capable of modulation of the viability of a cell or an immune response.
1. A composition for modulating an immune system, comprising:
(a) a fusion peptide comprising:
(i) a transporter peptide sequence;
(ii) a MYC polypeptide sequence; and, optionally,
(iii) one or more molecules that link the transporter peptide sequence and the MYC polypeptide sequence;
(b) a pharmacologically acceptable excipient; and
(c) an antigenic moiety.
2. The composition of claim 1 , wherein the fusion peptide has Formula (I):
transporter peptide sequence-MYC sequence.
3. The composition of claim 1 , wherein the fusion peptide has Formula (II):
transporter peptide sequence-X-MYC sequence,
wherein -X- is a molecule that links the transporter peptide sequence and the MYC sequence.
4. The composition of claim 1 , wherein the fusion peptide has Formula (II):
transporter peptide sequence-X-MYC sequence,
wherein in X is at least one amino acid.
5. The composition of claim 1 , wherein the fusion peptide has the following sequence (SEQ ID NO: 2):
MRKKRRQRRRMDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYC
DEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYV
AVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFI
KNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSS
LYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGK
RSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRV
KLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFF
ALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRRE
QLKHKLEQLRKGELNSKLEGKPIPNPLLGLDSTRTGHHHHHH.
6. The composition of claim 1 , wherein the antigenic moiety is a pathogen, a toxoid, a peptide, a nucleic acid sequence, a polysaccharide, or a combination thereof.
7. The composition of claim 1 , wherein the antigenic moiety is derived from a pathogen selected from: hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; meningococcal; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis; human papillomavirus; or combinations thereof.
8. The composition of claim 1 , wherein the antigenic moiety is derived from a neoplastic cell.
9. The composition of claim 1 , formulated for topical administration.
10. A method of enhancing an immune response, comprising administering to an individual in need thereof the composition of claim 1 .
11. The method of claim 10 , wherein the peptide has Formula (I):
transporter peptide sequence-MYC sequence.
12. The method of claim 10 , wherein the peptide has Formula (II):
transporter peptide sequence-X-MYC sequence,
wherein -X- is a molecule that links the transporter peptide sequence and the MYC sequence.
13. The method of claim 10 , wherein the peptide has Formula (II):
transporter peptide sequence-X-MYC sequence,
wherein in X is at least one amino acid.
14. The method of claim 10 , wherein the peptide has the following sequence (SEQ ID NO: 2):
MRKKRRQRRRMDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYC
DEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYV
AVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFI
KNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSS
LYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGK
RSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRV
KLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFF
ALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRRE
QLKHKLEQLRKGELNSKLEGKPIPNPLLGLDSTRTGHHHHHH.
15. The method of claim 10 , wherein the antigenic moiety is derived from a pathogen selected from: hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; meningococcal; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis; human papillomavirus; or combinations thereof.
16. The method of claim 10 , wherein the antigenic moiety is derived from a neoplastic cell.