Targeted antimicrobial moieties
This invention provides novel targeted antimicrobial compositions. In various embodiments chimeric moieties are provided comprising an antimicrobial peptide attached to a peptide targeting moiety that binds a bacterial strain or species.
1. A chimeric moiety, said moiety comprising: an effector attached to a peptide targeting moiety comprising the amino acid sequence:
(SEQ ID NO: 26)
MKMRAGQVVFIYKLILVLLFYV LQKLFDLKKGCF.
2. The chimeric moiety of claim 1 , wherein said targeting moiety is a peptide consisting of the amino acid sequence:
(SEQ ID NO: 26)
MKMRAGQVVFIYKLILVLLFYVLQKLFDLKK GCF.
3. The chimeric moiety of claim 1 , wherein said effector comprises a moiety selected from the group consisting of a detectable label, an antimicrobial peptide, an antibiotic, and a photosensitizer.
4. The chimeric moiety of claim 1 , wherein said effector comprises an antimicrobial peptide.
5. The chimeric moiety of claim 1 , wherein said effector comprises an antibiotic.
6. The chimeric moiety of claim 1 , wherein said effector comprises a photosensitizing agent.
7. The chimeric moiety of claim 6 , wherein said effector comprises a photosensitizing agent selected from the group consisting of a porphyrinic macrocycle, a porphyrin, a chlorine, a crown ether, an acridine, an azine, a phthalocyanine, a cyanine, a psoralen, and a perylenequinonoid.
8. The chimeric moiety of claim 4 , wherein said effector comprises an antimicrobial peptide wherein said antimicrobial peptide comprises the amino acid sequence:
(SEQ ID NO: 1820)
KNLRIIRKGIHIIKKY.
9. The chimeric moiety of claim 8 , wherein said antimicrobial peptide consists of the amino acid sequence:
(SEQ ID NO: 1820)
KNLRIIRKGIHIIKKY.
10. The chimeric moiety according to any one of claims 1 - 7 , 8 , and 9 , wherein said targeting moiety is chemically conjugated to said effector.
11. The chimeric moiety of claim 10 , wherein said targeting moiety is chemically conjugated to said effector via a linker.
12. The chimeric moiety of claim 10 , wherein said targeting moiety is chemically conjugated to said effector via a linker comprising a polyethylene glycol (PEG).
13. The chimeric moiety of claim 10 , wherein said targeting moiety is chemically conjugated to said effector via a non-peptide linker.
14. The chimeric moiety according to any one of claims 1 - 7 , 8 , and 9 , wherein said targeting moiety is linked directly to said effector.
15. The chimeric moiety according to any one of claims 1 - 7 , 8 , and 9 , wherein said targeting moiety is linked to said effector via a peptide linker.
16. The chimeric moiety according to any one of claims 4 , 8 , and 9 , wherein the chimeric moiety is a fusion protein.
17. The chimeric moiety of claim 16 , wherein said targeting moiety is attached to said effector via a peptide linker comprising an amino acid sequence selected from the group consisting of AAA (SEQ ID NO:NO:1936), GGG (SEQ ID NO:1937), SGG (SEQ ID NO:1938), GGSGGS (SEQ ID NO:1939), SAT (SEQ ID NO:1940), pyp (SEQ ID NO:1941), PSPSP (SEQ ID NO:1942), ASA (SEQ ID NO:1943), ASASA (SEQ ID NO:1944), PSPSP (SEQ ID NO:1945), KKKIZ (SEQ ID NO:1946), RRRR (SEQ ID NO:1947), GGGGSGGGGSGGGGS (SEQ ID NO:1948), GGGG (SEQ ID NO:1954), GGGGS (SEQ ID NO:1955), GGGGSGGGGS (SEQ ID NO:1956), GGGGSGGGGSGGGGSGGGGS (SEQ ID NO:1957), GGGGSGGGGSG GGGSGGGGSGGGGS (SEQ ID NO:1958), and GGGGSGGGGSGGGGSGGGGSGGGGSG GGGS (SEQ ID NO:1959).
18. The chimeric moiety of claim 15 , wherein said chimeric moiety is functionalized with a polymer to increase serum halflife.
19. The chimeric moiety of claim 16 , wherein said polymer comprises polyethylene glycol and/or a cellulose or modified cellulose.
20. A pharmaceutical composition comprising a chimeric moiety according to any one of claims 1 - 7 , 8 , and 9 in a pharmaceutically acceptable carrier.
21. The composition of claim 20 , wherein said composition is formulated as a unit dosage formulation.
22. The composition of claim 20 , wherein said composition is formulated for administration by a modality selected from the group consisting of intraperitoneal administration, topical administration, oral administration, inhalation administration, transdermal administration, subdermal depot administration, and rectal administration.
23. The chimeric moiety of claim 5 , wherein said effector comprises an antibiotic is selected from the group consisting of Amikacin, Gentamicin, Kanamycin, Neomycin, Netilmicin, Streptomycin, Tobramycin, Paromomycin, Loracarbef, Ertapenem, Doripenem, Imipenem, Cilastatin, Meropenem, Cefadroxil, Cefazolin, Cefalotin, Cefalothin, Cefalexin, Cefaclor, Cefamandole, Cefoxitin, Cefprozil, Cefuroxime, Cefixime, Cefdinir, Cefditoren, Cefoperazone, Cefotaxime, Cefpodoxime, Ceftazidime, Ceftibuten, Ceftizoxime, Ceftriaxone, Cefepime, Ceftobiprole, Teicoplanin, Vancomycin, Macrolides, Zithromax, Biaxin, Dirithromycin, Erythocin, Erythroped, Roxithromycin, Troleandomycin, Ketek, Aztreonam, Amoxicillin, Ampicillin, Azlocillin, Carbenicillin, Cloxacillin, Dicloxacillin, Flucloxacillin, Mezlocillin, Meticillin, Nafcillin, Oxacillin, Penicillin, Piperacillin, Ticarcillin, Bacitracin, Colistin, Polymyxin B, Mafenide, Prontosil, Sulfacetamide, Sulfamethizole, Sulfanilimide, Sulfasalazine, Sulfisoxazole, Trimethoprim Trimethoprim-Sulfamethoxazole (Co-trimoxazole) (TMP-SMX), Demeclocycline, Doxycycline, Minocycline, Oxytetracycline, Tetracycline, squalamine, CSA-8, CSA-11, CSA-13, CSA-15, CSA-25, CSA-46, CSA-54, CSA-90, CSA-97, Arsphenamine, Chloramphenicol, Clindamycin, Lincomycin, Ethambutol, Fosfomycin, Fusidic acid, Furazolidone, Isoniazid, Linezolid, Metronidazole, Mupirocin, Nitrofurantoin, Platensimycin, Pyrazinamide, Quinupristin, Dalfopristin, Rifampin, Rifampicin, and Timidazole.
24. The chimeric moiety of claim 16 , wherein said targeting moiety is attached to said effector via a peptide linker the amino acid sequence of which consists of the sequence GGG (SEQ ID NO: 1937).
25. The chimeric moiety of claim 7 , wherein said photosensitizing agent is a porphyrin.
26. The chimeric moiety of claim 7 , wherein said photosensitizing agent is a phthalocyanine.
27. The chimeric moiety of claim 7 , wherein said photosensitizing agent is a compound according to the formula:
wherein the substitutions at positions M, and Y are selected from the group consisting of:
M is 2H and Y is SO 3 H; and
M is 2H and Y is N(CH 3 ) 3 + .
28. The chimeric moiety of claim 7 , wherein said photosensitizing agent is a compound according to the formula:
wherein the substitutions at positions M, and X are selected from the group consisting of:
M is HOSiOSiCH 2 CH 2 N(CH 3 ) 2 , and X is H;
M is GaIII, AlIII, or ZnII, and X is SO 3 H or C(CH 3 ) 2 ;
M is 2H and X is C(CH 3 ) 2 ;
M is Zn and X is
M is Zn and X is SO 2 N(CH 2 CH 2 OH) 2 ;
M is Zn and X is SO 3 H.
29. The chimeric moiety of claim 7 , wherein said photosensitizing agent is a compound selected from the group consisting of Monoastral Fast Blue B, and Monoastral Fast Blue G.
30. The chimeric moiety of claim 7 , wherein said photosensitizing agent is an azine photosensitizer.
31. The chimeric moiety of claim 7 , wherein said photosensitizing agent is selected from the group consisting of methylene blue, toluidine blue 0, neutral red, proflavine, acridine orange, aminacrine, and ethacridine.
32. The chimeric moiety of claim 7 , wherein said photosensitizing agent is a cyanine.
33. The chimeric moiety of claim 7 , wherein said photosensitizing agent is selected from the group consisting of psoralen, thienocoumarin, 8-azacoumarin, 2-thiofuranocoumarin, and 2-selenofuranocoumarin.
34. The chimeric moiety of claim 7 , wherein said photosensitizing agent is selected from the group consisting of hypocrellin A, hypocrellin B, and calphostin C.
35. The chimeric moiety of claim 7 , wherein said photosensitizing agent is an acridine.
36. The chimeric moiety of claim 7 , wherein said photosensitizing agent is rose bengal.
37. The composition of claim 7 , wherein said photosensitizing agent is a crown ether.