Therapeutic Dosing of a Neuregulin or a Subsequence Thereof for Treatment or Pro-phylaxis of Heart Failure
The invention relates to treatment of heart failure in a mammal. Accordingly, the invention is directed to establishing a dosing regimen whereby the therapeutic benefits conferred by administration of a neuregulin such as glial growth factor 2 (GGF2) or a subsequence thereof are maintained and/or enhanced, while concomitantly minimizing any potential side effects.
1 . A method for treating or preventing heart failure in a mammal, said method comprising:
providing a peptide comprising an epidermal growth factor-like (EGF-like) domain ;
administering a therapeutically effective amount of said peptide to a mammal at an interval of at least 48 hours, wherein said therapeutically effective amount is effective to treat or prevent heart failure in said mammal.
2 . The method of claim 1 , wherein said administering is performed every 48 hours.
3 . The method of claim 1 , wherein said administering is performed every 96 hours.
4 . The method of claim 1 , wherein said administration is performed on a regimen selected from the group consisting of every: four days, week, 10 days, 14 days, month, two months, three months or four months.
5 . The method of claim 1 , wherein said mammal is a human.
6 . The method of claim 1 , wherein said peptide is recombinant human GGF2.
7 . The method of claim wherein the peptide is:
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQ
NYVMASFYKAEELYQ.
8 . The method of claim wherein the peptide is:
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQ
NYVMASFYKAEELY.
9 . The method of claim 1 , wherein said peptide is encoded by the neuregulin (NRG)-1 gene, the neuregulin (NRG)-2 gene, the neuregulin (NRG)-3 gene, or the neuregulin (NRG)-4 gene.