Microcrystalline Y receptor agonists
View Patent ↗The disclosure provides microcrystals of Y receptor agonists; microcrystalline pellets of Y receptor agonists, and microcrystalline suspensions of Y receptor agonists. Pharmaceutical compositions containing these microcrystals, microcrystalline pellets, and microcrystalline suspensions have prolonged pharmacokinetic profiles making them useful for once daily or once weekly administration.
1. A microcrystal comprising a Y receptor agonist peptide, wherein the microcrystal has a particle size of about 1 micron to about 15 microns and is birefringent when viewed under a polarized light microscope, wherein the Y receptor agonist peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-483.
2. The microcrystal of claim 1 , wherein the Y receptor agonist peptide has at least 80% sequence identity to the amino acid sequence of SEQ ID NO:3 (PYY(3-36)):IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY.
3. A pharmaceutical composition comprising a plurality of microcrystals according to claim 1 .
4. The pharmaceutical composition of claim 3 further comprising an aqueous solution.
5. The pharmaceutical composition of claim 4 , further comprising a polyol.
6. The pharmaceutical composition of claim 5 , wherein the polyol is glycerol, mannitol, sorbitol, sucrose, glycol, ethylene glycol, pentaerythritol, or a combination thereof.
7. A method for treating diabetes, overweight, obesity, fatty liver disease, a gastrointestinal disease, hypertension, dyslipidemia, cardiovascular disease, a myocardial infarction, atherosclerosis, an eating disorder, or insulin-resistance in a patient in need thereof comprising administering a therapeutically effective amount of the pharmaceutical composition of claim 3 .
8. The microcrystal of claim 1 , wherein the Y receptor agonist peptide comprises the amino acid sequence of SEQ ID NO:281, 438, 439.
9. The microcrystal of claim 1 , wherein the Y receptor agonist peptide comprises the amino acid sequence of SEQ ID NO: 438.