Monoclonal antibodies to programmed death 1 (PD-1)
The present invention provides isolated monoclonal antibodies, particularly human monoclonal antibodies, that specifically bind to PD-1 with high affinity. Nucleic acid molecules encoding the antibodies of the invention, expression vectors, host cells and methods for expressing the antibodies of the invention are also provided. Immunoconjugates, bispecific molecules and pharmaceutical compositions comprising the antibodies of the invention are also provided. The invention also provides methods for detecting PD-1, as well as methods for treating various diseases, including cancer and infectious diseases, using anti-PD-1 antibodies. The present invention further provides methods for using a combination immunotherapy, such as the combination of anti-CTLA-4 and anti-PD-1 antibodies, to treat hyperproliferative disease, such as cancer. The invention also provides methods for altering adverse events related to treatment with such antibodies individually.
1. A monoclonal antibody or an antigen-binding portion thereof that cross-competes for binding to human PD-1 with a reference antibody or antigen-binding portion thereof, wherein the reference antibody or antigen-binding portion thereof comprises a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains selected from:
(a) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 15; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 22; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 29; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 36; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 43; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 50;
(b) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 16; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 23; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 30; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 37; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 44; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 51;
(c) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 18; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 25; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 32; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 39; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 46; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 53; and
(d) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 20; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 27; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 34; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 41; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 48; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 55;
wherein the monoclonal antibody or antigen-binding portion thereof comprises a heavy chain variable region, which comprises CDR1, CDR2, CDR3, framework region (FR) 1, FR2, FR3, and FR4, and a light chain variable region, which comprises CDR1, CDR2, CDR3, FR1 FR2, FR3, and FR4,
wherein the monoclonal antibody or antigen-binding portion thereof binds to human PD-1 with a K D of 1×10 −8 M or less, wherein the K D is measured by surface plasmon resonance (Biacore) analysis, and
wherein the light chain variable region FR1 of the monoclonal antibody or antigen-binding portion thereof comprises the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) or EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) containing one amino acid mutation.
2. The monoclonal antibody or the antigen-binding portion thereof of claim 1 , wherein the light chain variable region FR2 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 76) or WYQQKPGQAPRLLIY (SEQ ID NO: 76) containing one amino acid mutation.
3. The monoclonal antibody or the antigen-binding portion thereof of claim 1 , wherein the light chain variable region FR3 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) or GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) containing one amino acid mutation.
4. The monoclonal antibody or the antigen-binding portion thereof of claim 1 , wherein the light chain variable region FR4 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 78) or FGGGTKVEIK (SEQ ID NO: 78) containing one amino acid mutation.
5. The monoclonal antibody or the antigen-binding portion thereof of claim 1 , wherein the light chain variable region FR2 and FR4 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 76) and the amino acid sequence of FGGGTKVEIK (SEQ ID NO 78), respectively.
6. The monoclonal antibody or the antigen-binding portion thereof of claim 5 , wherein the heavy chain variable region FR4 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 82) or WGQGTLVTVSS (SEQ ID NO:82) containing one amino acid mutation.
7. The monoclonal antibody or the antigen-binding portion thereof of claim 1 , wherein the light chain variable regions FR2, FR3, and FR4 of the monoclonal antibody or the antigen-binding portion thereof comprises (i) the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 76) or WYQQKPGQAPRLLIY (SEQ ID NO: 76) containing one amino acid mutation, (ii) the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) or GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) containing one amino acid mutation, and (iii) the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 78) or FGGGTKVEIK (SEQ ID NO: 78) containing one amino acid mutation, respectively.
8. The monoclonal antibody or the antigen-binding portion thereof of claim 7 , wherein the heavy chain variable region FR4 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 82) or WGQGTLVTVSS (SEQ ID NO: 82) containing one amino acid mutation.
9. The monoclonal antibody or antigen-binding portion thereof of claim 8 , wherein the K D is 5×10 −9 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
10. The monoclonal antibody or antigen-binding portion thereof of claim 8 , wherein the K D is 1×10 −9 or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
11. The monoclonal antibody or antigen-binding portion thereof of claim 8 , which mediates neither ADCC activity nor CDC activity.
12. The monoclonal antibody of claim 8 , comprising a heavy chain constant region which is of a human IgG1, IgG2, IgG3, or IgG4 isotype.
13. The monoclonal antibody of claim 12 , wherein the heavy chain constant region is of a human IgG4 isotype.
14. A monoclonal antibody or an antigen-binding portion thereof that cross-competes for binding to PD-1 with a reference antibody or antigen-binding portion thereof, wherein the reference antibody or antigen-binding portion thereof comprises a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains selected from:
(a) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 15; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 22; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 29; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 36; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 43; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 50;
(b) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 16; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 23; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ NO: 30; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 37; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 44; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO 51;
(c) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 18; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 25; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 32; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 39; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 46; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 53; and
(d) a heavy chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 20; a heavy chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 27; a heavy chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 34; a light chain CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 41; a light chain CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 48; and a light chain CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 55;
wherein the monoclonal antibody or antigen-binding portion thereof comprises a heavy chain variable region, which comprises CDR1, CDR2, CDR3, FR1, FR2, FR3, and FR4, and a light chain variable region, which comprises CDR1, CDR2, CDR3, FR1, FR2, FR3, and FR4,
wherein each of the light chain variable regions FR1, FR2, and FR3 of the monoclonal antibody or antigen-binding portion thereof comprise an amino acid sequence at least 90% identical to each of FR1, FR2, and FR3 of the human VK L6 germline sequence, respectively, and the light chain variable region FR4 of the monoclonal antibody or antigen-binding portion thereof comprises an amino acid sequence at least 90% identical to FR4 of the human VK JK1 or JK4 germline sequence; and
wherein the monoclonal antibody or antigen-binding portion thereof exhibits at least one of the following properties:
(i) binds to human PD-1 with a K D of 1×10 −7 M or less, wherein the K D is measured by surface plasmon resonance (Biacore) analysis;
(ii) binds to human PD-1 with an on rate (k on ) of about 0.76×10 5 l/Ms or more, wherein the on rate (k on ) is measured by surface plasmon resonance (Biacore) analysis; and
(iii) binds to human PD-1 with an off rate (k off ) of about 4.5×10 −4 l/s or less, wherein the off rate (k off ) is measured by surface plasmon resonance (Biacore) analysis.
15. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the light chain variable region FR4 of the monoclonal antibody or antigen-binding portion thereof comprises an amino acid sequence at least 90% identical to FR4 of the human VK JK4 germline sequence.
16. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein each of the heavy chain variable regions FR1, FR2, and FR3 of the monoclonal antibody or antigen-binding portion thereof comprises an amino acid sequence at least 90% identical to each of FR1, FR2, and FR3 of the human VH 3-33 germline sequence, respectively, and the heavy chain variable region FR4 comprises an amino acid sequence at least 90% identical to FR4 of the human VH JH4b germline sequence.
17. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the light chain variable region FR1 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) or EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) containing one amino acid mutation.
18. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the light chain variable region FR2 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 76) or WYQQKPGQAPRLLIY (SEQ ID NO: 76) containing one amino acid mutation.
19. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the light chain variable region FR3 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO 77) or GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) containing one amino acid mutation.
20. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the light chain variable region FR4 of the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 78) or FGGGTKVEIK (SEQ ID NO: 78) containing one amino acid mutation.
21. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the light chain variable regions FR1, FR2, FR3, and FR4 in the monoclonal antibody or the antigen-binding portion thereof comprise (i) the amino acid sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) or EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 75) containing one amino acid mutation, (ii) the amino acid sequence of WYQQKPGQAPRLLIY (SEQ ID NO: 76) or WYQQKPGQAPRLLIY (SEQ ID NO: 76) containing one amino acid mutation, (iii) the amino acid sequence of GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) or GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC (SEQ ID NO: 77) containing one amino acid mutation, and (iv) the amino acid sequence of FGGGTKVEIK (SEQ ID NO: 78) or FGGGTKVEIK (SEQ ID NO: 78) containing one amino acid mutation, respectively.
22. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the heavy chain variable region FR1 in the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of QVQLVESGGDVVQPGRSLRLSCAASGLTFT (SEQ ID NO 79) or QVQLVESGGDVVQPGRSLRLSCAASGLTFT (SEQ ID NO: 79) containing one amino acid mutation.
23. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the heavy chain variable region FR2 in the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WVRQAPGKGLEWVA (SEQ ID NO: 80) or WVRQAPGKGLEWVA (SEQ ID NO: 80) containing one amino acid mutation.
24. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the heavy chain variable region FR3 in the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of RFTISRDNSKNTLYLQMNNLRAEDTAVYYCAT (SEQ ID NO: 81) or RFTISRDNSKNTLYLQMNNLRAEDTAVYYCAT (SEQ ID NO: 81) containing one amino acid mutation.
25. The monoclonal antibody or the antigen-binding portion thereof of claim 14 , wherein the heavy chain variable region FR4 in the monoclonal antibody or the antigen-binding portion thereof comprises the amino acid sequence of WGQGTLVTVSS (SEQ ID NO: 82) or WGQGTLVTVSS (SEQ ID NO: 82) containing one amino acid mutation.
26. The monoclonal antibody or the antigen-binding portion thereof of claim 21 , wherein the monoclonal antibody or the antigen-binding portion thereof binds to human PD-1 with a K D of 5×10 −9 M or less and wherein the K D is measured by surface plasmon resonance (Biacore) analysis.
27. The monoclonal antibody or the antigen-binding portion thereof of claim 21 , wherein the monoclonal antibody or the antigen-binding portion thereof binds to human PD-1 with an on rate (k on ) of about 2.56×10 5 l/Ms or more and wherein the on rate (k on ) is measured by surface plasmon resonance (Biacore) analysis.
28. The monoclonal antibody or the antigen-binding portion thereof of claim 21 , wherein the monoclonal antibody or the antigen-binding portion thereof binds to human PD-1 with an off rate (k off ) of about 4.5×10 −4 l/s or less and wherein the off rate (k off ) is measured by surface plasmon resonance (Biacore) analysis.
29. The monoclonal antibody or antigen-binding portion thereof of claim 21 , which inhibits the suppression of CD4 + CD25 − T cells by regulatory T cells.
30. The monoclonal antibody or antigen-binding portion thereof of claim 21 , which enhances the antigen specific-memory response to a tumor or a pathogen.
31. The monoclonal antibody or antigen-binding portion thereof of claim 21 , which confers a persistent immunity to tumor relapse.
32. The monoclonal antibody or antigen-binding portion thereof of claim 21 , which increases activation of T cells.
33. The monoclonal antibody or antigen-binding portion thereof of claim 14 , further comprising a heavy chain constant region which is of a human IgG1, IgG2, IgG3, or IgG4 isotype.
34. The monoclonal antibody or antigen-binding portion thereof of claim 14 , which is of an IgG1 isotype.
35. The monoclonal antibody or antigen-binding portion thereof of claim 14 , which is of an IgG4 isotype.
36. The monoclonal antibody or antigen-binding portion thereof of claim 21 , which mediates neither ADCC activity nor CDC activity.
37. The monoclonal antibody or antigen-binding portion thereof of claim 1 or 14 , further comprising a light chain constant region which is a human kappa or lambda constant region.
38. The monoclonal antibody of claim 1 or 14 , which is a humanized antibody.
39. The monoclonal antibody of claim 1 or 14 , which is a human antibody.
40. The antigen-binding portion thereof of claim 1 or 14 , which is a Fab, Fab′, F(ab′)2, dAb, Fd, Fv, or a single chain Fv fragment or an isolated CDR.
41. The monoclonal antibody or antigen-binding portion thereof of claim 1 or 14 , wherein the CDR sequences are delineated using the Kabat system of CDR determination.
42. A composition comprising the monoclonal antibody or antigen-binding portion thereof of claim 1 or 14 , and a pharmaceutically acceptable carrier.
43. An immunoconjugate comprising the monoclonal antibody or antigen-binding portion thereof of claim 1 or 14 , linked to a therapeutic agent.
44. The immunoconjugate of claim 43 , wherein the therapeutic agent is a cytotoxin or a radioactive isotope.
45. A bispecific molecule comprising the monoclonal antibody or antigen-binding portion thereof of claim 1 or 14 , linked to a second functional moiety having a different binding specificity than the monoclonal antibody, or antigen-binding portion thereof.