Malaria antigens and methods of use
The invention is directed to a composition comprising one or more polypeptides or one or more nucleic acid sequences that can induce a protective immune response against Plasmodium species that infect humans. The invention also is directed to a method of using such compositions to induce a protective immune response against a Plasmodium parasite in a mammal.
1. A method of inducing a protective immune response against a Plasmodium parasite in a mammal, wherein the method comprises administering to the mammal a composition comprising a pharmaceutically acceptable carrier and one or more isolated polypeptides, wherein each of the one or more isolated polypeptides comprises:
(a) an amino acid sequence comprising at least 20 contiguous amino acid residues of the sequence MKKDREPIDEDEMRITSTGRMTNYVNYGAKILG (SEQ ID NO: 20),
(b) an amino acid sequence comprising at least 20 contiguous amino acid residues of the sequence KIKATGNAIGKAVTLAEIIKRRFKGLHQIT (SEQ ID NO: 21), or
(c) an amino acid sequence comprising SEQ ID NO: 22,
and wherein each of the one or more isolated polypeptides induces a protective immune response against Plasmodium falciparum and/or Plasmodium vivax in a mammal.
2. The method of claim 1 , wherein the composition comprises an isolated polypeptide comprising at least 20 contiguous amino acid residues of the sequence MKKDREPIDEDEMRITSTGRMTNYVNYGAKILG (SEQ ID NO: 20).
3. The method of claim 2 , wherein the composition comprises an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 20.
4. The method of claim 1 , wherein the composition comprises an isolated polypeptide comprising at least 20 contiguous amino acid residues of the sequence KIKATGNAIGKAVTLAEIIKRRFKGLHQIT (SEQ ID NO: 21).
5. The method of claim 4 , wherein the composition comprises an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 21.
6. The method of claim 1 , wherein the composition comprises an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 22.
7. The method of claim 6 , wherein the isolated polypeptide comprises the amino acid sequence of KDAGYQPPLDEKYVKEMXPEEIVN (SEQ ID NO: 23), wherein X is a serine (S) residue or a threonine (T) residue.
8. The method of claim 1 , wherein the composition comprises a polypeptide comprising the amino acid sequence of SEQ ID NO: 24, SEQ ID NO: 25, or SEQ ID NO: 26.
9. The method of claim 1 , wherein the mammal is a human.
10. A method of inducing a protective immune response against a Plasmodium parasite in a mammal, wherein the method comprises administering to the mammal a composition comprising a pharmaceutically acceptable carrier and one or more isolated polypeptides, wherein each of the one or more isolated polypeptides comprises:
(a) an amino acid sequence comprising at least 20 contiguous amino acid residues of the sequence MKKDREPIDEDEMRITSTGRMTNYVNYGAKILG (SEQ ID NO: 20), (b) an amino acid sequence comprising at least 20 contiguous amino acid residues of the sequence KIKATGNAIGKAVTLAEIIKRRFKGLHQIT (SEQ ID NO: 21), and
(c) an amino acid sequence comprising SEQ ID NO: 22,
and wherein each of the one or more isolated polypeptides induces a protective immune response against Plasmodium falciparum and/or Plasmodium vivax in a mammal.
11. The method of claim 10 , wherein the isolated polypeptide comprises the amino acid sequence of KDAGYQPPLDEKYVKEMXPEEIVN (SEQ ID NO: 23), wherein X is a serine (S) residue or a threonine (T) residue.
12. The method of claim 10 , wherein one or more isolated polypeptides comprises the amino acid sequences of SEQ ID NO: 20, SEQ ID NO: 21, and SEQ ID NO: 22.
13. The method of claim 12 , wherein the isolated polypeptide comprises the amino acid sequence of KDAGYQPPLDEKYVKEMXPEEIVN (SEQ ID NO: 23), wherein X is a serine (S) residue or a threonine (T) residue.
14. The method of claim 13 , wherein the mammal is a human.
15. The method of claim 10 , wherein the mammal is a human.
16. The method of claim 11 , wherein the mammal is a human.
17. The method of claim 12 , wherein the mammal is a human.
18. A method of inducing a protective immune response against a Plasmodium parasite in a mammal, wherein the method comprises administering to the mammal a composition comprising a pharmaceutically acceptable carrier and one or more polypeptides comprising the amino acid sequence of SEQ ID NO: 24, wherein the Plasmodium parasite is Plasmodium falciparum or Plasmodium vivax.
19. The method of claim 18 , wherein the mammal is a human.
20. A method of inducing a protective immune response against a Plasmodium parasite in a mammal, wherein the method comprises administering to the mammal a composition comprising a pharmaceutically acceptable carrier and one or more polypeptides comprising the amino acid sequence of SEQ ID NO: 25, wherein the Plasmodium parasite is Plasmodium falciparum or Plasmodium vivax.
21. The method of claim 20 , wherein the mammal is a human.
22. A method of inducing a protective immune response against a Plasmodium parasite in a mammal, wherein the method comprises administering to the mammal a composition comprising a pharmaceutically acceptable carrier and one or more polypeptides comprising the amino acid sequence of SEQ ID NO: 26, wherein the Plasmodium parasite is Plasmodium falciparum or Plasmodium vivax.
23. The method of claim 22 , wherein the mammal is a human.