Anti-CXCR4 antibodies and antibody-drug conjugates
View Patent ↗The present invention provides antibodies and related molecules that bind to chemokine receptor 4 (CXCR4). The invention further provides antibody-drug conjugates comprising such antibodies, antibody encoding nucleic acids, and methods of obtaining such antibodies. The invention further relates to therapeutic methods for use of these antibodies and anti-CXCR4 antibody-drug conjugates for the treatment of a disorder associated with CXCR4 function or expression (e.g., cancer), such as colon, RCC, esophageal, gastric, head and neck, lung, ovarian, pancreatic cancer or hematological cancers.
1. An isolated antibody, or an antigen binding fragment thereof, that binds to chemokine receptor 4 (CXCR4) and comprises:
a) a heavy chain variable (VH) region comprising (i) a VH CDR1 selected from the group consisting of SEQ ID NOs:107, 113 and 114; (ii) a VH CDR2 selected from the group consisting of SEQ ID NOs: 162 and 128; and (iii) a VH CDR3 set forth as SEQ ID NO: 112; and
b) a light chain variable region (VL) region comprising (i) a VL CDR1 set forth as SEQ ID NO: 144; (ii) a VL CDR2 set forth as SEQ ID NO: 145; and (iii) a VL CDR3 set forth as SEQ ID NO: 139.
2. An isolated antibody, or an antigen binding fragment thereof, that binds to chemokine receptor 4 (CXCR4) and comprises:
a) a light chain variable (VL) region comprising (i) a VL CDR1 comprising the sequence X1SX2X3SLFNSX4X5RKNYLX6 wherein X1 is R or K; X2 is S or A; X3 is W, N or Q; X4 is H or R; X5 is T or F; and X6 is A, L, N, or M (SEQ ID NO: 151); (ii) a VL CDR2 comprising the sequence WASARX1S wherein X1 is G or E (SEQ ID NO: 152); and (iii) a VL CDR3 comprising the sequence KQSFX1LRT wherein X1 is N or R (SEQ ID NO: 153); and
b) a heavy chain variable (VH) region comprising (i) a VH CDR1 comprising the sequence set forth as SEQ ID NOs: 107, 108, 109, 113, or 114; (ii) a VH CDR2 comprising the sequence set forth as SEQ ID NO: 157; and (iii) a VH CDR3 comprising the sequence set forth as SEQ ID NO: 112.
3. An isolated antibody, or an antigen binding fragment thereof, that binds to chemokine receptor 4 (CXCR4) and comprises:
a) a heavy chain variable (VH) region sequence comprising: EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVX1FIRHKX2NX3X4TX5E YSTX6X7X8GRFTISRDX9SKNX10LYLQMNSLX11X12EDTAVYYCAX13DLPGFAYWGQGTLVTVS S (SEQ ID NO: 106), wherein X1 is G or S; X2 is V or A; X3 is G, F, K, V, T, L, or I; X4 is E or Y; X5 is T or R; X6 is W or S; X7 is D or V; X8 is K, T, or R; X9 is D or N; X10 is T or S; X11 is R or K; X12 is A or T; and X13 is K or R;
b) a light chain variable region (VL) region comprising (i) a VL CDR1 set forth as SEQ ID NO: 144; (ii) a VL CDR2 set forth as SEQ ID NO: 145; and (iii) a VL CDR3 set forth as SEQ ID NO: 139.
4. The isolated antibody or antigen binding fragment thereof that binds to chemokine receptor 4 (CXCR4) selected from the group consisting of:
a) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107, 113 or 114; a VH CDR2 of SEQ ID NO:162 or 128; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:144; a VL CDR2 of SEQ ID NO:145; and a VL CDR3 of SEQ ID NO:139;
b) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:115, 116, 117, 121 or 122; a VH CDR2 of SEQ ID NO:118 or 119; and a VH CDR3 of SEQ ID NO:120; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:135; a VL CDR2 of SEQ ID NO:136; and a VL CDR3 of SEQ ID NO:137;
c) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107, 108, 109, 113 or 114; a VH CDR2 of SEQ ID NO:110 or 111; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:131; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:133;
d) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107, 108, 109, 113 or 114; a VH CDR2 of SEQ ID NO:154 or 123; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:139; and
e) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107, 108, 109, 113 or 114; a VH CDR2 of SEQ ID NO:15; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:151; a VL CDR2 of SEQ ID NO:152; and a VL CDR3 of SEQ ID NO:153.
5. The isolated antibody or antigen binding fragment thereof wherein the antibody comprises a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:162; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:144; a VL CDR2 of SEQ ID NO:145; and a VL CDR3 of SEQ ID NO:139.
6. The isolated antibody or antigen fragment thereof of claim 5 , wherein the antibody or antigen fragment thereof comprises a heavy chain variable region having an amino acid sequence that is at least 95% identical to SEQ ID NO: 33; and a light chain variable having an amino acid sequence that is at least 95% identical to SEQ ID NO: 73.
7. An isolated antibody or antigen binding fragment thereof that binds to chemokine receptor 4 (CXCR4) selected from the group consisting of:
a) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:158; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:139;
b) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:158; and a VH CDR3 of SEQ ID NO:112; and alight chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
c) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:158; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:150; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
d) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:158; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:141; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
e) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:158; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:144; a VL CDR2 of SEQ ID NO:145; and a VL CDR3 of SEQ ID NO:140;
f) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:158; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:147; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
g) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:159; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
h) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:160; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
i) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:161; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
j) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:162; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
k) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:163; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
l) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:164; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
m) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:165; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
n) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:166; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
o) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:167; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
p) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:168; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:138; a VL CDR2 of SEQ ID NO:132; and a VL CDR3 of SEQ ID NO:140;
q) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:163; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:144; a VL CDR2 of SEQ ID NO:145; and a VL CDR3 of SEQ ID NO:140;
r) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:158; and a VH CDR3 of SEQ ID NO:112; and a VL region having a VL CDR1 of SEQ ID NO:144; a VL CDR2 of SEQ ID NO:145; and a VL CDR3 of SEQ ID NO:139;
s) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:162; and a VH CDR3 of SEQ ID NO:112 and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:144; a VL CDR2 of SEQ ID NO:145; and a VL CDR3 of SEQ ID NO:139;
t) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:163; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:144; a VL CDR2 of SEQ ID NO:145; and a VL CDR3 of SEQ ID NO:139; and
u) a heavy chain variable (VH) region having a VH CDR1 of SEQ ID NO:107; a VH CDR2 of SEQ ID NO:162; and a VH CDR3 of SEQ ID NO:112; and a light chain variable (VL) region having a VL CDR1 of SEQ ID NO:144; a VL CDR2 of SEQ ID NO:145; and a VL CDR3 of SEQ ID NO:140.
8. The antibody or antigen binding fragment thereof of claim 1 , wherein the antibody comprises: a heavy chain variable (VH) region comprising VH CDR1, VH CDR2 and VH CDR3 from a VH region of SEQ ID NO: 33.
9. The antibody or antigen binding fragment thereof any one of claim 1 , wherein the antibody comprises: a light chain variable (VL) region comprising VL CDR1, VL CDR2 and VL CDR3 from a VL region of SEQ ID NO: 73.
10. An isolated antibody, or an antigen binding fragment thereof of claim 1 , wherein the antibody comprises:
a) a heavy chain variable (VH) region comprising VH CDR1, VH CDR2 and VH CDR3 from a VH region of SEQ ID NO: 33; and
b) a light chain variable (VL) region comprising VL CDR1, VL CDR2 and VL CDR3 from a VL region of SEQ ID NO: 73.
11. An antibody or antigen binding fragment thereof of claim 1 , wherein the antibody comprises:
a) a heavy chain variable (VH) region of SEQ ID NO: 33; and
b) a light chain variable (VL) region of SEQ ID NO: 73.
12. The antibody or the antigen binding fragment of claim 1 , wherein the antibody comprises a heavy chain variable (VH) region produced by the expression vector with ATCC Accession No. PTA-121353.
13. The antibody or the antigen binding fragment of claim 1 , wherein the antibody comprises a light chain variable (VL) region produced by the expression vector with ATCC Accession No. PTA-121354.
14. The antibody or antigen binding fragment thereof of claim 1 , wherein the antibody is a humanized, chimeric, CDR grafted, or recombinant human antibody.
15. The antibody or antigen binding fragment thereof of claim 1 , wherein the antibody is not caninized or felinized.
16. The antibody or antigen binding fragment thereof of claim 1 , wherein the antibody comprises an acyl donor glutamine-containing tag engineered at a specific site.
17. An antibody-drug conjugate of the formula:
Ab-(T-L-D),
wherein:
(a) Ab is an antibody or antigen-binding fragment thereof of claim 1 that binds to chemokine receptor 4 (CXCR4);
(b) T is an acyl donor glutamine-containing tag that can be optionally included;
(c) L is a linker; and
(d) D is a drug.
18. The antibody-drug conjugate of claim 17 , wherein Ab is selected from the group consisting of:
a) an antibody or antigen-binding fragment thereof comprising a heavy chain variable (VH) region comprising CDRs of SEQ ID NOs: 107, 162 and 112; and a light chain variable (VL) region comprising CDRs of SEQ ID NOs: 144, 145 and 139; and
b) an antibody or antigen-binding fragment thereof comprising a heavy chain variable (VH) region of SEQ ID NO:33; and a light chain variable (VL) region of SEQ ID NO:73.
19. The antibody-drug conjugate of claim 17 , wherein Ab is a humanized, chimeric, CDR grafted, or recombinant human antibody or antigen binding fragment thereof.
20. The antibody-drug conjugate of claim 17 , wherein T is SEQ ID NO: 102.
21. The antibody-drug conjugate of claim 17 , wherein T is selected from the group consisting of SEQ ID NOs: 91, 92 and 102.
22. The antibody-drug conjugate of claim 17 , wherein L is acetyl-lysine-valine-citrulline-p-aminobenzyloxycarbonyl (AcLys-VC-PABC).
23. The antibody-drug conjugate of claim 17 , wherein D is selected from the group consisting of a cytotoxic agent, an immunomodulating agent, an imaging agent, a therapeutic protein, a biopolymer, and an oligonucleotide.
24. The antibody-drug conjugate of claim 23 , wherein D is a cytotoxic agent.
25. The antibody-drug conjugate of claim 24 , wherein the cytotoxic agent is selected from the group consisting of an anthracycline, an auristatin, a camptothecin, a combretastain, a dolastatin, a duocarmycin, an enediyne, a geldanamycin, an indolino-benzodiazepine dimer, a maytansine, a puromycin, a pyrrolobenzodiazepine dimer, a taxane, a vinca alkaloid, a tubulysin, a hemiasterlin, a spliceostatin, a pladienolide, and calicheamicin.
26. The antibody-drug conjugate of claim 25 , wherein the cytotoxic agent is an auristatin.
27. The antibody-drug conjugate of claim 17 , wherein D is an auristatin cytotoxic agent, wherein the auristatin is 0101 (2-methylalanyl-N-[(3R,4 S,5 S)-3-methoxy-1-{(2 S)-2-[(1R,2R)-1-methoxy-2-methyl-3-oxo-3-{[(1 S)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino}propyl]pyrrolidin-1-yl}-5-methyl-1-oxoheptan-4-yl]-N-methyl-L-valinamide).
28. The antibody-drug conjugate of claim 17 , wherein the conjugate is Ab-LLQX1X2X3X4X5 (SEQ ID NO: 102)-(AcLys-VC-PABC)-0101.
29. The antibody-drug conjugate of claim 28 , wherein Ab is an antibody or antigen-binding fragment thereof comprising a heavy chain variable (VH) region comprising CDRs of SEQ ID NOs: 107, 162 and 112; and a light chain variable (VL) region comprising CDRs of SEQ ID NOs: 144, 145 and 139.
30. A pharmaceutical composition comprising a therapeutically effective amount of the antibody or antigen binding fragment thereof of claim 1 or the conjugate of any one of claims 17 - 20 , 22 , 27 and 28 and a pharmaceutically acceptable carrier.
31. A method of treating a disorder associated with chemokine receptor 4 (CXCR4) function or expression in a subject comprising administering to a subject in need thereof an effective amount of the pharmaceutical composition of claim 30 .
32. The method of claim 31 , wherein the disorder is a cancer.
33. The method of claim 32 , wherein the cancer is a hematological cancer.
34. The method of claim 32 , wherein the cancer is a B cell or a T cell malignancy.
35. The method of claim 32 , wherein the cancer is selected from the group consisting of acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), multiple myeloma (MM), non-Hodgkin's lymphoma (NHL), Hodgkin's lymphoma, mantle cell lymphoma (MCL), follicular lymphoma, Waldenstrom's macroglobulinemia (WM), B-cell lymphoma, and diffuse large B-cell lymphoma (DLBCL).
36. The method of claim 32 , wherein the cancer is selected from the group consisting of bladder, breast, cervical, choriocarcinoma, colon, esophageal, gastric, glioblastoma, head and neck, kidney, lung, oral, ovarian, pancreatic, prostate, and skin cancer.
37. A method of decreasing tumor growth or progression in a subject who has a CXCR4-expressing tumor, comprising administering to the subject in need thereof an effective amount of the pharmaceutical composition of claim 30 .
38. A method of decreasing metastasis of CXCR4-expressing cancer cells in a subject, comprising administering to the subject in need thereof an effective amount of the pharmaceutical composition of claim 30 .
39. A method of inducing tumor regression in a subject who has a CXCR4-expressing tumor, comprising administering to the subject in need thereof an effective amount of the pharmaceutical composition of claim 30 .
40. An isolated antibody or antigen binding fragment thereof of claim 1 or the antibody-drug conjugate of claim 17 , for use in detecting, diagnosing and/or treating a disorder associated with expression of chemokine receptor 4 (CXCR4).
41. The isolated antibody or antigen binding fragment thereof of claim 1 or the antibody-drug conjugate of claim 17 for treating cancer.
42. The isolated antibody or antigen binding fragment thereof; or the antibody-drug conjugate of claim 41 , wherein the cancer is a hematological cancer.
43. The isolated antibody or antigen binding fragment thereof; or the antibody-drug conjugate of claim 41 , wherein the cancer is a B cell or a T cell malignancy.
44. The isolated antibody or antigen binding fragment thereof; or the antibody-drug conjugate of claim 41 , wherein the cancer is selected from the group consisting of acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), multiple myeloma (MM), non-Hodgkin's lymphoma (NHL), Hodgkin's lymphoma, mantle cell lymphoma (MCL), follicular lymphoma, Waldenstrom's macroglobulinemia (WM), B-cell lymphoma and diffuse large B-cell lymphoma (DLBCL).
45. The isolated antibody or antigen binding fragment thereof; or the antibody-drug conjugate of claim 41 , wherein the cancer is selected from the group consisting of bladder, breast, cervical, choriocarcinoma, colon, esophageal, gastric, glioblastoma, head and neck, kidney, lung, oral, ovarian, pancreatic, prostate, and skin cancer.