Antibody specific for CD22 and methods of use thereof

1. A composition comprising (i) an antibody that specifically binds an epitope in CD22, wherein the antibody comprises:

a) an immunoglobulin heavy chain comprising a VH region having the amino acid sequence EVQLVESGGGLVKPGGSLX 1 LSCAASGFAFSIYDMSWVRQAPGKGLEWVAYISSGGGTT YYPDTVKGRFTISRDNAKNX 2 LYLQMX 3 SLRAEDTAMYYCARHSGYGSSYGVLFAYWG QGTLVTVSS (SEQ ID NO:1), where X 1 is K or R; X 2 is S or T; and X 3 is N or S; and

b) an immunoglobulin light chain; and

(ii) a carrier.

2. The composition of claim 1 , wherein the immunoglobulin light chain comprises the amino acid sequence

(SEQ ID NO: 7; VK1)

DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAVKLL

IYYTSILHSGVPSRFSGSGSGTDYTLTISSLQQEDFATYFCQQGNTL

PWTFGGGTKVEIK.

3. The composition of claim 1 , wherein the immunoglobulin light chain comprises the amino acid sequence

(SEQ ID NO: 8; VK2)

DIQMTQSPSSLSASVGDRVTITCRASQDISNYLNWYQQKPGKAVKLL

IYYTSILHSGVPSRFSGSGSGTDYTLTISSLQPEDFATYFCQQGNTL

PWTFGGGTKVEIK.

4. The composition of claim 1 , wherein the immunoglobulin light chain comprises the amino acid sequence

(SEQ ID NO: 9; VK4)

DIQMTQSPSSVSASVGDRVTITCRASQDISNYLNWYQQKPGKAPKLL

IYYTSILHSGVPSRFSGSGSGTDYTLTISSLQPEDFATYFCQQGNTL

PWTFGGGTKVEIK.

5. A composition comprising (i) an antibody that specifically binds an epitope in CD22, wherein the antibody comprises:

a) an immunoglobulin light chain comprising the amino acid sequence DIQMTQSPSSX 1 SASVGDRVTITCRASQDISNYLNWYQQKPGKAX 2 KLLIYYTSILHSGVP SRFSGSGSGTDYTLTISSLQX 3 EDFATYFCQQGNTLPWTFGGGTKVEIK (SEQ ID NO:2), where X 1 is L (Leu) or V (Val); X 2 is V or P; and X 3 is Q or P; and

b) an immunoglobulin heavy chain; and

(ii) a carrier.

6. The composition of claim 5 , wherein the immunoglobulin heavy chain comprises an amino acid sequence selected from:

(SEQ ID NO: 3; VH3)

EVQLVESGGGLVKPGGSLKLSCAASGFAFSIYDMSWVRQAPGKGLEW

VAYISSGGGTTYYPDTVKGRFTISRDNAKNTLYLQMSSLRAEDTAMY

YCARHSGYGSSYGVLFAYWGQGTLVTVSS;

(SEQ ID NO: 4; VH4)

EVQLVESGGGLVKPGGSLRLSCAASGFAFSIYDMSWVRQAPGKGLEW

VAYISSGGGTTYYPDTVKGRFTISRDNAKNSLYLQMSSLRAEDTAMY

YCARHSGYGSSYGVLFAYWGQGTLVTVSS;

(SEQ ID NO: 5; VH5)

EVQLVESGGGLVKPGGSLKLSCAASGFAFSIYDMSWVRQAPGKGLEW

VAYISSGGGTTYYPDTVKGRFTISRDNAKNSLYLQMNSLRAEDTAMY

YCARHSGYGSSYGVLFAYWGQGTLVTVSS;

and

(SEQ ID NO: 6; VH6)

EVQLVESGGGLVKPGGSLKLSCAASGFAFSIYDMSWVRQAPGKGLEW

VAYISSGGGTTYYPDTVKGRFTISRDNAKNSLYLQMSSLRAEDTAMY

YCARHSGYGSSYGVLFAYWGQGTLVTVSS.

7. The composition of claim 5 , wherein the light chain region and the heavy chain region are present in separate polypeptides.

8. The composition of claim 5 , wherein the light chain region and the heavy chain region are present in a single polypeptide.

9. The composition of claim 5 , wherein the antibody binds the epitope with an affinity of from about 10 7 M −1 to about 10 12 M −1 .

10. The composition of claim 5 , wherein the heavy chain region is of the isotype IgG1, IgG2, IgG3, or IgG4.

11. The composition of claim 5 , wherein the antibody is detectably labeled.

12. The composition of claim 5 , wherein the antibody is a F v , scF v , F ab , F( ab′ ) 2 , or F ab′ .

13. The composition of claim 5 , wherein the antibody comprises a covalently linked non-peptide synthetic polymer.

14. The composition of claim 13 , wherein the synthetic polymer is poly(ethylene glycol) polymer.

15. The composition of claim 5 , wherein the antibody comprises a covalently linked lipid or fatty acid moiety.

16. The composition of claim 5 , wherein the antibody comprises a covalently linked polysaccharide or carbohydrate moiety.

17. The composition of claim 5 , wherein the antibody comprises a contrast agent.

18. The composition of claim 5 , wherein the antibody comprises an affinity domain.

19. The composition of claim 5 , wherein the antibody is immobilized on a solid support.

20. The composition of claim 5 , wherein the antibody is a single chain F v (scF v ) antibody.

21. The composition of claim 20 , wherein the scF v is multimerized.

22. The composition of claim 5 , wherein the antibody comprises a covalently linked cytotoxin.

23. The composition of claim 5 , wherein the antibody comprises a constant region amino acid sequence comprising an amino acid sequence of a sulfatase motif.

24. The composition of claim 5 , wherein the antibody comprises a constant region amino acid sequence comprising an amino acid sequence of a sulfatase motif, and wherein the sulfatase motif is modified to comprise a 2-formylglycine (FGly) moiety.

25. The composition of claim 24 , wherein the antibody comprises a heterologous moiety covalently linked to the antibody via the FGly moiety.

26. The composition of claim 25 , wherein the heterologous moiety is selected from a drug, a toxin, a detectable label, a water-soluble polymer, and a synthetic peptide.

27. A pharmaceutical composition comprising:

a) an effective amount of the composition of claim 1 ; and

b) a pharmaceutically acceptable carrier.

28. The pharmaceutical composition of claim 27 , wherein the antibody is encapsulated in a liposome.

29. A pharmaceutical composition comprising:

a) the composition of claim 5 ; and

b) a pharmaceutically acceptable carrier.

30. A method of treating B cell malignancy in a subject, the method comprising:

administering to a subject having cancer an effective amount of the pharmaceutical composition of claim 29 .