B7X and its derivatives for treating and preventing cardiovascular disease
Methods are disclosed for preventing and/or treating cardiovascular diseases comprising administering B7x or a derivative of B7x to a patient in need thereof.
1. A method of inhibiting atherosclerosis progression in a patient comprising administering to the patient a B7x derivative in an amount and manner effective to inhibit atherosclerosis progression in a patient, wherein the B7x derivative is a B7x Ig fusion protein that comprises the extracellular domain of B7x fused to a human IgG1 fragment crystallizable region having the amino acid sequence
(SEQ ID NO: 3)
SKTSGSEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL
HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
2. The method of claim 1 , wherein the patient is a human.
3. The method of claim 1 , wherein the B7x Ig fusion protein is administered in an amount and manner effective to reduce an atherosclerotic lesion in a patient.