Therapy for filovirus infection
The present invention addresses a need for improved treatments for Filovirus infections.
1. An isolated humanized anti-Filovirus glycoprotein pre-fusion core antibody comprising a framework region having a sequence of 95% or greater identity to a human antibody framework region, and comprising
(a) a heavy chain CDR1 comprising GFAFNYYDMH (SEQ ID NO:1); a heavy chain CDR2 comprising YINPGGGNTYYADSV (SEQ ID NO:2); and a heavy chain CDR3 comprising QLYGNSFMDY (SEQ ID NO:3), and
(b) a light chain sequence DIQMTQSPSSLSASVGDRVTITCQASQDVTTAVAWYQQKPGKAPKL (SEQ ID NO:12) comprising a light chain CDR1, a light chain sequence LIYAASGRHKGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQ (SEQ ID NO:13) comprising a light chain CDR2, and a light chain CDR3 comprising HYSTPLT (SEQ ID NO:5).
2. The humanized antibody of claim 1 , wherein the heavy chain comprises the sequence EVQLVESGGGLVQPGGSLRLSCAASGFAFNYYDMHWVRQAPGKGLE (SEQ ID NO:8).
3. The humanized antibody of claim 1 , wherein the heavy chain comprises the sequence WVAYINPGGGNTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTA (SEQ ID NO:9).
4. The humanized antibody of claim 1 , wherein the heavy chain comprises the sequence VYYCARQLYGNSFMDYWGQGTLVTV (SEQ ID NO:10).
5. The humanized antibody of claim 1 , wherein the light chain comprises the sequence HYSTPLTFGQGTKVFI (SEQ ID NO:16).
6. An antigen-binding fragment of the antibody of claim 1 .
7. A composition comprising the antibody of claim 1 or an antigen-binding fragment thereof.
8. The composition of claim 7 , comprising a pharmaceutically acceptably carrier.
9. A method of inhibiting an Ebola virus infection of a subject comprising administering to the subject an amount of the antibody of claim 1 or an antigen-binding fragment thereof effective to inhibit an Ebola virus infection in a subject, wherein administration is prior to the subject being exposed to the Ebola virus, further wherein the Ebola virus is the Sudan strain.