Plasma kallikrein inhibitors and uses thereof for treating hereditary angioedema attack
Provided herein are plasma kallikrein antibodies binding to active plasma kallikrein and methods of using such antibodies in treating and preventing hereditary angioedema attack, such method may involve a first treatment period and optionally, a second treatment period. Also provided are methods of using such antibodies in treating hereditary angioedema involving a single dose of the antibody to a subject who has undergone a prior HAE treatment, followed by multiple doses of the same antibody if the subject experiences an HAE attack after the single dose.
1. A method for treating hereditary angioedema (HAE) attack or reducing the rate of HAE attack, the method comprising:
(i) administering to a subject in need thereof an antibody at a single dose of about 300 mg, wherein the antibody comprises a heavy chain complementarity determining region (HCDR) 1 set forth as HYIMM (SEQ ID NO: 5), a HCDR2 set forth as GIYSSGGITVYADSVKG (SEQ ID NO: 6), a HCDR3 set forth as RRIGVPRRDEFDI (SEQ ID NO: 7) and light chain complementarity determining region (LCDR) 1 set forth as RASQSISSWLA (SEQ ID NO: 8), a LCDR2 set forth as KASTLES (SEQ ID NO: 9), and a LCDR3 set forth as QQYNTYWT (SEQ ID NO: 10), and wherein the subject has undergone a first HAE treatment comprising administering the antibody to the subject in multiple doses of about 300 mg every two weeks; and
(ii) further administering to the subject the antibody in one or more doses of about 300 mg, after the subject experiences an HAE attack after (i).
2. The method of claim 1 , wherein in step (ii), the subject is administered multiple doses of the antibody at about 300 mg every two weeks.
3. The method of claim 1 , wherein the first dose of step (ii) is within one week after the HAE attack; and/or wherein the single dose of (i) and the first dose of (ii) are at least 10 days apart.
4. The method of claim 1 , wherein the antibody comprises a heavy chain variable domain set forth as EVQLLESGGGLVQPGGSLRLSCAASGFTFSHYIMMWVRQAPGKGLEWVSGIYSSGGITV YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAYRRIGVPRRDEFDIWGQGTM VTVSS (SEQ ID NO: 3) and a light chain variable domain set forth as DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASTLESGVPS RFSGSGSGTEFTLTISSLQPDDFATYYCQQYNTYWTFGQGTKVEIK (SEQ ID NO: 4).
5. The method of claim 1 , wherein the antibody is a full length antibody or an antigen-binding fragment thereof.
6. The method of claim 5 , wherein the antibody is an IgG molecule.
7. The method of claim 6 , wherein the antibody is an IgG1 molecule.
8. The method of claim 5 , wherein the antibody comprises a heavy chain set forth as SEQ ID NO: 1 and a light chain set forth as SEQ ID NO: 2.
9. The method of claim 1 , wherein the antibody is formulated in a pharmaceutical composition comprising sodium phosphate, citric acid, histidine, sodium chloride, and polysorbate 80.
10. The method of claim 9 , wherein the antibody is formulated in about 30 mM sodium phosphate, about 19 mM citric acid, about 50 mM histidine, about 90 mM sodium chloride, and about 0.01% polysorbate 80.
11. The method of claim 1 , wherein the antibody is administered subcutaneously.
12. The method of claim 1 , wherein the subject:
(i) is a human patient having, suspected of having, or at risk for HAE;
(ii) is a human patient having HAE type I or type II;
(iii) is a human patient who had experienced at least two HAE attacks per year prior to the first HAE treatment; and/or
(iv) is a human patient who has received one or more prior HAE treatments prior to the first HAE treatment.
13. The method of claim 12 , wherein the prior HAE treatment comprises a C1-inhibitor (C1-INH), a plasma kallikrein inhibitor, a bradykinin receptor antagonist, an androgen, an anti-tranexamic acid, or a combination thereof.
14. The method of claim 13 , wherein the prior HAE comprises a C1-INH, ecallantide, icatibant, danazol, tranexamic acid, or a combination thereof.
15. The method of claim 12 , wherein the subject has undergone a tapering period for the one or more prior HAE treatments.
16. The method of claim 15 , wherein the tapering period is about 2-4 weeks.
17. The method of claim 12 , wherein the one or more prior HAE treatments terminate either before the first dose of the antibody in the first HAE treatment or within three weeks after the first dose of the antibody in the first HAE treatment.
18. The method of claim 1 , wherein the subject is a human patient who is free of a long-term prophylaxis for HAE, or an HAE treatment involving an angiotensin-converting enzyme (ACE) inhibitor, an estrogen-containing medication, or an androgen prior to the first HAE treatment, during the first HAE treatment, and/or of during (i) and (ii).
19. The method of claim 1 , wherein the first HAE treatment period is 26 weeks or longer.