Systems methods, and compositions for targeted nucleic acid editing
The invention provides for systems, methods, and compositions for targeting and editing nucleic acids. In particular, the invention provides non-naturally occurring or engineered RNA-targeting systems comprising a RNA-targeting Cas13 protein, at least one guide molecule, and at least one adenosine deaminase protein or catalytic domain thereof.
1. An engineered composition for site directed base editing comprising:
a) a targeting domain; and
b) an adenosine deaminase or catalytic domain thereof, wherein the adenosine deaminase is modified to convert activity to a cytidine deaminase, wherein the adenosine deaminase or catalytic domain thereof comprises one or more mutations selected from P462A, N597I, or both of a human ADAR2 or mutations corresponding thereto in a homologue, ortholog, or variant thereof.
2. The composition of claim 1 , wherein the adenosine deaminase further comprises one or more mutations
at one or more positions selected from E396, C451, V351, R455, T375, K376, S486, Q488, R510, K594, R348, G593, S397, H443, L444, Y445, F442, E438, T448, A353, V355, T339, P539, V525 and I520 of a human ADAR2 or in positions corresponding thereto in a homologue, ortholog, or variant thereof;
at one or more positions selected from E488, V351, S486, T375, and S370 of a human ADAR2 or in positions corresponding thereto in a homologue, ortholog, or variant thereof, or
selected from E488Q, V351G, S486A, T375S, and S370C of a human ADAR2 or mutations corresponding thereto in a homologue, ortholog, or variant thereof.
3. The composition of claim 1 , wherein the adenosine deaminase or catalytic domain thereof is a human, cephalopod, or Drosophila adenosine deaminase or catalytic domain thereof, or is covalently or non-covalently linked to the targeting domain.
4. The composition of claim 1 , wherein said adenosine deaminase or catalytic domain thereof has been modified to comprise a mutation at glutamic acid 488 of a hADAR2-D amino acid sequence, or a corresponding position in a homologous ADAR protein.
5. The composition of claim 4 , wherein said glutamic acid 488 or a corresponding position in a homologous ADAR protein is replaced by a glutamine residue (E488Q); or said adenosine deaminase or catalytic domain thereof is a mutated hADAR2d comprising mutation E488Q or a mutated hADAR1d comprising mutation E1008Q.
6. The composition of claim 1 , wherein the targeting domain is a catalytically inactive Cas13 protein, or a nucleotide sequence encoding said catalytically inactive Cas13 protein.
7. The composition of claim 6 , wherein the catalytically inactive Cas13 protein is catalytically inactive Cas13a, catalytically inactive Cas13b, or catalytically inactive Cas13c; is obtained from a Cas13 nuclease derived from a bacterial species selected from the group consisting of Leptotrichia shahii, L wadei, L wadei F0279, Listeria seeligeri , Lachnospiraceae bacterium MA2020, Lachnospiraceae bacterium NK4A179, [ Clostridium] aminophilum DSM 10710 , Carnobacterium gallinarum DSM 4847 , Paludibacter propionicigenes WB4, Listeria weihenstephanensis FSL R9-0317, Listeriaceae bacterium FSL M6-0635 , Leptotrichia wadei F0279, Rhodobacter capsulatus SB 1003, Rhodobacter capsulatus R121, Rhodobacter capsulatus DE442 , Leptotrichia buccalis C-1013-b, Herbinix hemicellulosilytica, [ Eubacterium] rectale , Eubacteriaceae bacterium CHKCI004 , Blautia sp. Marseille-P2398 , Leptotrichia sp. oral taxon 879 str. F0557, Lachnospiraceae bacterium NK4A144 , Chloroflexus aggregans, Demequina aurantiaca, Thalassospira sp. TSL5-1, SAMN04487830_13920 [Pseudobutyrivibrio sp. OR37], SAMN02910398_00008 [ Butyrivibrio sp. YAB3001 ], Leptotrichia sp. Marseille-P3007, Bacteroides ihuae , SAMN05216357_1045 [Porphyromonadaceae bacterium KH3CP3RA], Listeria riparia, Insolitispirillum peregrinum, Bergeyella zoohelcum, Prevotella intermedia, Prevotella buccae, Porphyromonas gingivalis, Alistipes sp. ZOR0009, Bacteroides pyogenes, Prevotella sp. MA2016 , Riemerella anatipestifer, Prevotella aurantiaca, Prevotella saccharolytica , HMPREF9712_03108 [Myroides odoratimimus CCUG 10230 ], Capnocytophaga canimorsus, Porphyromonas gulae, Prevotella sp. P5-125, Flavobacterium branchiophilum, Myroides odoratimimus, Flavobacterium columnare, Porphyromonas sp. COT-052 OH4946, PIN17_0200 [ Prevotella intermedia 17], HMPREF6485_0083 [ Prevotella buccae ATCC 33574], HMPREF9144_1146 [ Prevotella pallens ATCC 700821], HMPREF9714_02132 [Myroides odoratimimus CCUG 12901], HMPREF9711_00870 [Myroides odoratimimus CCUG 3837], HMPREF9699_02005 [Bergeyella zoohelcum ATCC 43767], HMPREF9151_01387 [ Prevotella saccharolytica F0055], A343_1752 [ Porphyromonas gingivalis JCVI SC001], HMPREF1981_03090 [ Bacteroides pyogenes F0041], HMPREF1553_02065 [ Porphyromonas gingivalis F0568], HMPREF1988_01768 [ Porphyromonas gingivalis F0185], HMPREF1990_01800 [ Porphyromonas gingivalis W4087], M573_117042 [ Prevotella intermedia ZT], A2033_10205 [Bacteroidetes bacterium GWA2_31_9], SAMN05421542_0666 [ Chryseobacterium jejuense ], SAMN05444360_11366 [ Chryseobacterium carnipullorum ], SAMN05421786_1011119, Prevotella pallens, [Chryseobacterium ureilyticum], Prevotella sp. MSX73 , Paludibacter propionicigenes, Psychroflexus torquis, Prevotella pleuritidis, Prevotella falsenii, Capnocytophaga cynodegmi, Prevotella sp. P5-119, Prevotella sp. P4-76, Prevotella sp. P5-60 , Phaeodactylibacter xiamenensis, Flavobacterium sp. 316 , Sinomicrobium oceani, Chryseobacterium sp. YR477 , Reichenbachiella agariperforans, Fusobacterium necrophorum, Fusobacterium necrophorum subsp. funduliforme, Fusobacterium necrophorum subsp. funduliforme ATCC 51357, Fusobacterium necrophorum DJ-2, Fusobacterium necrophorum BFTR-1, Fusobacterium necrophorum subsp. funduliforme 1_1_36S, Fusobacterium perfoetens ATCC 29250, Fusobacterium ulcerans ATCC 49185 , Anaerosalibacter sp. ND1, or Anaerosalibacter massiliensis ND1; or is a Cas13 protein having a sequence of any one of SEQ ID NO: 34-161.
8. An engineered, non-naturally occurring system for modifying an cytosine in a target locus of interest, comprising the composition of claim 6 and
c) a guide molecule which comprises a guide sequence linked to a direct repeat sequence, or a nucleotide sequence encoding said guide molecule;
wherein said adenosine deaminase or catalytic domain thereof is covalently or non-covalently linked to said catalytically inactive Cas13 protein or said guide molecule or is adapted to link thereto after delivery; and
wherein said guide sequence is capable of hybridizing with a target RNA sequence in a target RNA comprising an cytosine to form an RNA duplex, wherein said guide sequence comprises a non-pairing adenosine or uracil at a position corresponding to said cytosine resulting in an C-A/U mismatch in the RNA duplex formed.
9. The composition of claim 1 , further comprising a guide molecule which comprises a guide sequence linked to a direct repeat sequence, or a nucleotide sequence encoding said guide molecule.
10. An engineered, non-naturally occurring vector system for modifying a cytosine in a target locus of interest, comprising one or more polynucleotides comprising encoding sequences of a), and b) of claim 1 .
11. The engineered, non-naturally occurring vector system of claim 10 , comprising one or more vectors comprising:
i) a first regulatory element operably linked to a nucleotide sequence encoding a guide molecule which comprises a guide sequence,
ii) a second regulatory element operably linked to a nucleotide sequence encoding a catalytically inactive Cas13 protein, and
iii) a nucleotide sequence encoding the adenosine deaminase protein or catalytic domain thereof which is under control of said first regulatory element or said second regulatory element or operably linked to a third regulatory element;
wherein, if said nucleotide sequence encoding said adenosine deaminase protein or catalytic domain thereof is operably linked to a third regulatory element, said adenosine deaminase protein or catalytic domain thereof is adapted to link to said guide molecule or said catalytically inactive Cas13 protein after expression;
wherein components (i), (ii), and (iii) are located on the same or on different vectors of the system.
12. A method of modifying an cytosine in a target RNA sequence of interest, comprising delivering to said target RNA the system of claim 8
wherein said adenosine deaminase or catalytic domain thereof deaminates said cytosine in said RNA duplex.
13. The method of claim 12 , wherein said adenosine deaminase or catalytic domain thereof is fused to N- or C-terminus of said catalytically inactive Cas13 protein.
14. The method of claim 13 , wherein said adenosine deaminase or catalytic domain thereof is fused to said catalytically inactive Cas13 protein by a linker.
15. The method of claim 14 , wherein said linker is (GGGGS) 3-11 (SEQ ID Nos: 1-9), GSG 5 (SEQ ID No: 10) or LEPGEKPYKCPECGKSFSQSGALTRHQRTHTR (SEQ ID No: 11), or wherein said linker is an XTEN linker.
16. The method of claim 12 , wherein said adenosine deaminase or catalytic domain thereof is linked to an adaptor protein and said guide molecule or said catalytically inactive Cas13 protein comprises an aptamer sequence capable of binding to said adaptor protein.
17. The method of claim 16 , wherein said adaptor protein is selected from the group consisting of MS2, PP7, Qβ, F2, GA, fr, JP501, M12, R17, BZ13, JP34, JP500, KU1, M11, MX1, TW18, VK, SP, FI, ID2, NL95, TW19, AP205, ϕCb5, ϕCb8r, ϕCb12r, ϕCb23r, 7s, and PRR1.
18. The method of claim 17 , wherein said adenosine deaminase or catalytic domain thereof is inserted into an internal loop of said catalytically inactive Cas13 protein.
19. The method of claim 18 , wherein said catalytically inactive Cas13 protein is:
a catalytically inactive Cas13a protein comprising two HEPN domains and said catalytically inactive Cas13a protein comprises one or more mutations in the two HEPN domains;
a catalytically inactive Cas13b protein and said catalytically inactive Cas13b protein comprises a mutation in one or more of positions R116, H121, R1177, or H1182 of a Cas13b protein originating from Bergeyella zoohelcum ATCC 43767 or amino acid positions corresponding thereto of a Cas13b ortholog; or
a catalytically inactive Cas13b protein and said catalytically inactive Cas13b protein comprises one or more mutations R116A, H121A, R1177A, or H1182A of a Cas13b protein originating from Bergeyella zoohelcum ATCC 43767 or amino acid positions corresponding thereto of a Cas13b ortholog.
20. The method of claim 19 , wherein the one or more mutations in the two HEPN domains comprise of position R474 and R1046 of a Cas 13a protein originating from Leptotrichia wadei or amino acid positions corresponding thereto of a Cas13a protein ortholog.
21. The method of claim 12 , wherein said guide sequence has a length of from about 20 to about 53 nt, from about 25 to about 53 nt, from about 29 to about 53 nt, or from about 40 to about 50 nt and is capable of forming said RNA duplex with said target RNA sequence of interest.
22. The method of claim 12 , wherein
a distance between a non-pairing A/U and the 5′ end of said guide sequence is 20-30 nucleotides;
the guide sequence comprises more than one mismatch corresponding to different cytosine sites in the target RNA sequence of interest or wherein two guide molecules are used, each comprising a mismatch corresponding to a different cytosine sites in the target RNA sequence of interest;
said catalytically inactive Cas13 protein comprise one or more heterologous nuclear localization signal(s) (NLS(s)); or
said method comprises, determining said target RNA sequence of interest and selecting said adenosine deaminase or catalytic domain thereof which most efficiently deaminates said cytosine present in said target RNA sequence of interest.
23. The method of claim 22 , wherein said adenosine deaminase or catalytic domain thereof comprise one or more heterologous nuclear localization signal(s) (NLS(s)).
24. The method of claim 12 , wherein said target RNA sequence of interest is within a cell.
25. The method of claim 24 , wherein said cell is a eukaryotic cell, a non-human animal cell, a human cell, a plant cell, an animal, a plant, or is comprises in a polynucleotide in vitro.
26. The method of claim 12 , wherein said components (a), (b) and (c) are delivered to a cell as a ribonucleoprotein complex or one or more polynucleotide molecules.
27. The method of claim 26 , wherein said one or more polynucleotide molecules:
comprise one or more mRNA molecules encoding components (a) and/or (c);
are comprised within one or more vectors; or
comprise one or more regulatory elements operably configured to express said catalytically inactive Cas13 protein, said guide molecule, and said adenosine deaminase or catalytic domain thereof.
28. The method of claim 27 , wherein said one or more regulatory elements comprise inducible promoters.
29. The method of claim 26 , wherein said one or more polynucleotide molecules or said ribonucleoprotein complex are delivered via particles, vesicles, or one or more viral vectors.
30. The method of claim 29 , wherein
said particles comprise a lipid, a sugar, a metal or a protein;
said particles comprise lipid nanoparticles;
said vesicles comprise exosomes or liposomes; or
said one or more viral vectors comprise one or more of adenovirus, one or more lentivirus or one or more adeno-associated virus.
31. The method of claim 12 , where said method modifies a cell, a cell line or an organism by manipulation of one or more target RNA sequences.
32. The method of claim 31 , wherein said deamination of said cytosine in said target RNA sequence of interest remedies a disease caused by transcripts containing a pathogenic T→C, or A→C point mutation.
33. The method of claim 31 , wherein
said modification affects fertility of an organism;
said modification affects splicing of said target RNA sequence of interest;
said modification introduces a mutation in a transcript introducing an amino acid change and causing expression of a new antigen in a cancer cell; or
said target RNA sequence of interest is comprised within a microRNA;
said deamination of said cytidine in said target RNA sequence of interest causes a gain of function or a loss of function of a gene; or
said deamination of said cytidine in said target RNA sequence of interest causes a gain of function or a loss of function of a gene expressed by a cancer cell.
34. The method of claim 12 , wherein
said catalytically inactive Cas13 protein is truncated; or
said adenosine deaminase or catalytic domain thereof has been modified further to comprise one or more additional mutation of the ADAR.
35. The method of claim 34 , wherein the ADAR is a huADAR.
36. The method of claim 35 , wherein the huADAR is (hu)ADAR1 or (hu)ADAR2.
37. The method of claim 34 , wherein the Cas13 protein is a catalytically inactive Cas13b protein, C-terminally truncated, or a catalytically inactive Cas 13 and is a truncated functional variant of a corresponding wild type Cas13;
the one or more additional mutation is selected from the group consisting of: R348E, V351L, T375S, T375G, R455E, R455S, R455G, N473D, R474E, K475Q, R477E, R481E, S486T, T490S, S495T, R510E, T490A, R348E, and E488Q, or a corresponding mutation in an ADAR homologue or ortholog;
or a combination thereof.