Ultra-long acting insulin-Fc fusion proteins and methods of use
View Patent ↗The present disclosure provides recombinantly manufactured ultra-long acting insulin-Fc fusion proteins for use in treating canine and feline diabetes. The insulin-Fc fusion proteins comprise an insulin polypeptide linked via a peptide linker to an Fc-fragment of canine or feline origin. Based on the results obtained, creating a treatment that is amenable to low cost manufacturing, exhibits sufficient in vivo bioactivity, displays extended duration of bioactivity, does not induce anti-drug antibodies, and substantially retains is potency over multiple administrations, requires a non-obvious combination of insulin polypeptide, peptide linkers, and species-specific Fc fragment, in addition to selective mutations on one or more of these components. Exemplary ultra-long acting insulin-Fc fusion proteins, polynucleotides encoding these insulin-Fc fusion proteins, and pharmaceutical formulations of exemplary insulin-Fc fusion proteins are provided, in addition to methods of use and preparation.
1. A fusion protein comprising an insulin polypeptide and an Fc fragment, wherein the insulin polypeptide and the Fc fragment are connected by a linker, wherein the Fc fragment is of non-human animal origin and comprises the following sequence:
(SEQ ID NO: 20)
DCPKCPPPEMLGGPSIFIFPPKPKDTLSISRTPEVTCLVVDLGPDDSDV
QITWFVDNTQVYTAKTSPREEQFNSTYRVVSVLPILHQDWLKGKEFKCK
VNSKSLPSPIERTISKDKGQPHEPQVYVLPPAQEELSRNKVSVTCLIEG
FYPSDIAVEWEITGQPEPENNYRTTPPQLDSDGTYFLYSRLSVDRSRWQ
RGNTYTCSVSHEALHSHHTQKSLTQSPG
and wherein the insulin polypeptide comprises the following sequence:
(SEQ ID NO: 6)
FVNQHLCGSX 1 LVEALELVCGERGFHYGGGGGGSGGGGGIVEQCCX 2 ST
CSLDQLENYCX 3
and wherein X 1 is not D, X 2 is not H, and X 3 is absent.
2. The fusion protein of claim 1 , wherein the insulin polypeptide comprises the following sequence:
(SEQ ID NO: 6)
FVNQHLCGSX 1 LVEALELVCGERGFHYGGGGGGSGGGGGIVEQCCX 2 ST
CSLDQLENYCX 3
wherein X 1 is H, X 2 is T, and X 3 is absent.
3. The fusion protein of claim 1 comprising domains in the following orientation from N- to C-terminus: (N-terminus)—insulin polypeptide—linker—Fc fragment—(C-terminus).
4. The fusion protein of claim 1 , wherein the insulin polypeptide and the Fc fragment are connected by a linker, comprising the following sequence:
(SEQ ID NO: 14)
GGGGGQGGGGQGGGGQGGGGG.
5. A fusion protein comprising an insulin polypeptide linked to an Fc fragment, wherein the fusion protein comprises the following sequence:
(SEQ ID NO: 38)
FVNQHLCGSHLVEALELVCGERGFHYGGGGGGSGGGGGIVEQCCTSTCSL
DQLENYCGGGGGQGGGGQGGGGQGGGGGDCPKCPPPEMLGGPSIFIFPPK
PKDTLSISRTPEVTCLVVDLGPDDSDVQITWFVDNTQVYTAKTSPREEQF
NSTYRVVSVLPILHQDWLKGKEFKCKVNSKSLPSPIERTISKDKGQPHEP
QVYVLPPAQEELSRNKVSVTCLIEGFYPSDIAVEWEITGQPEPENNYRTT
PPQLDSDGTYFLYSRLSVDRSRWQRGNTYTCSVSHEALHSHHTQKSLTQS
PG.
6. The fusion protein of claim 1 , wherein the fusion protein is a homodimer.
7. The fusion protein of claim 6 , wherein the percentage homodimer of the fusion protein is greater than 90%.
8. The fusion protein of claim 6 , wherein the resulting homodimer titer after purification using Protein A beads or a Protein A column is greater than 50 mg/L.
9. The fusion protein of claim 1 , wherein the insulin receptor IC50 for the fusion protein is less than or equal to 5000 nM.
10. The fusion protein of claim 1 wherein the serum half-life of the fusion protein in the blood or serum of a target animal upon administration is longer than about 3 days.
11. The fusion protein of claim 1 , wherein the time during which there is a statistically significant decrease in blood glucose level in a subject relative to a pre-dose level is longer than one of 2 hours, 6 hours, 9 hours, 12 hours, 18 hours, 1 day, 1.5 days, 2 days, 2.5 days, 3 days, 4 days, 5 days, 6 days, 7 days, or longer.
12. The fusion protein of claim 1 , wherein the NAOC after the first subcutaneous injection in a target animal is greater than 150% FBGL·days·kg/mg.
13. The fusion protein of claim 12 , wherein the ratio of the NAOC after the third weekly subcutaneous injection of the fusion protein in the target animal to the NAOC after the first subcutaneous injection of the fusion protein in the target animal is greater than 0.50.
14. The fusion protein of claim 1 , wherein the fusion protein is formulated as a pharmaceutical composition.
15. The pharmaceutical composition of claim 14 , wherein the fusion protein is present in the pharmaceutical composition at a concentration of about 3 mg/mL or greater.
16. The pharmaceutical composition of claim 14 , wherein the composition is suitable for subcutaneous administration.
17. A method for lowering the blood glucose of a target animal, the method comprising administering a physiologically effective amount of the fusion protein of claim 1 or a pharmaceutical composition thereof to the target animal, and wherein the target animal is a cat.
18. The method of claim 17 in which the target animal is diagnosed with diabetes.
19. The method of claim 17 , wherein the fusion protein is administered subcutaneously.
20. The method of claim 17 , wherein the fusion protein is administered daily, twice weekly, or once weekly to the target animal.
21. The method of claim 17 , wherein the fusion protein is administered once weekly to the target animal at a dose between 0.025 and 0.5 mg/kg/week.