Use of C-type natriuretic peptide variants to treat skeletal dysplasia
The present disclosure provides for use of variants of C-type natriuretic peptide (CNP), and novel pharmaceutical compositions and formulations comprising CNP variant peptides for the treatment of skeletal dysplasias, one or more symptoms of skeletal dysplasias, such as long bone growth or growth velocity, and other disorders having a skeletal dysplasia and/or CNP-associated symptom or component.
1. A method of increasing long bone growth in a subject in need thereof, said method comprising the step of administering to said subject a composition comprising:
(a) a CNP variant peptide in an amount of at least 7.5 μg/kg, wherein the CNP variant peptide is selected from the group consisting of:
(CNP-37(M32N); SEQ ID NO: 1)
QEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC;
(Met-CNP-37; SEQ ID NO: 2)
MQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
(Pro-CNP-37; SEQ ID NO: 3)
PQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
(Gly-CNP 37 (M32N); SEQ ID NO: 4)
GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC;
(Pro-Gly-CNP-37; SEQ ID NO: 5)
PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
(Met-Gly-CNP-37; SEQ ID NO: 6)
MGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
and
(Gly-CNP-37 or CNP-28: SEQ ID NO: 7)
GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC,
and
(b) citric acid monohydrate, sodium citrate dihydrate, trehalose dihydrate, D-mannitol, L-methionine and polysorbate 80,
wherein said step of administering increases long bone growth in said subject.
2. The method of claim 1 , wherein said subject has achondroplasia.
3. The method of claim 1 , wherein said composition is administered once daily.
4. The method of claim 3 , wherein said composition is administered once daily over a period of at least 6 months.
5. The method of claim 1 , wherein the composition is administered subcutaneously.
6. The method of claim 1 comprising administering said composition comprising said CNP variant peptide to said subject in an amount of at least 15 μg/kg, at least 30 μg/kg, or at least 60 μg/kg per day of said CNP variant peptide.
7. The method of claim 1 , wherein said citric acid monohydrate is present at a concentration of from about 0.15 mg/ml to about 0.40 mg/ml, said sodium citrate dihydrate is present at a concentration of from about 0.5 mg/ml to about 1.5 mg/ml, said trehalose dihydrate is present at a concentration of from about 30 mg/ml to about 70 mg/ml, said D-mannitol is present at a concentration of from about 10 mg/ml to about 20 mg/ml, said L-methionine is present at a concentration of from about 0.5 mg/ml to about 1.5 mg/ml and said polysorbate 80 is present at a concentration of from about 0.01 mg/ml to about 0.1 mg/ml.
8. The method of claim 1 , wherein said citric acid monohydrate is present at a concentration of about 0.28 mg/ml, said sodium citrate dihydrate is present at a concentration of about 1.08 mg/ml, said trehalose dihydrate is present at a concentration of about 58.01 mg/ml, said D-mannitol is present at a concentration of about 15 mg/ml, said L-methionine is present at a concentration of about 0.73 mg/ml and said polysorbate 80 is present at a concentration of about 0.05 mg/ml.
9. A method of increasing growth velocity in a subject in need thereof, said method comprising the step of administering to said subject a composition comprising:
(a) a CNP variant peptide in an amount of at least 7.5 μg/kg, wherein said CNP variant peptide is selected from the group consisting of:
(CNP-37(M32N); SEQ ID NO: 1)
QEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC;
(Met-CNP-37; SEQ ID NO: 2)
MQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
(Pro-CNP-37; SEQ ID NO: 3)
PQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
(Gly-CNP 37 (M32N); SEQ ID NO: 4)
GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC;
(Pro-Gly-CNP-37; SEQ ID NO: 5)
PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
(Met-Gly-CNP-37; SEQ ID NO: 6)
MGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
and
(Gly-CNP-37 or CNP-38: SEQ ID NO: 7)
GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC,
and
(b) citric acid monohydrate, sodium citrate dihydrate, trehalose dihydrate, D-mannitol, L-methionine and polysorbate 80,
wherein the step of administering increases growth velocity in said subject.
10. The method of claim 9 , wherein said subject has achondroplasia.
11. The method of claim 9 , wherein the increase in growth velocity is an increase in annualized growth velocity as measured by standing height of at least 25% above baseline in said subject.
12. The method of claim 9 , wherein the increase in growth velocity is an increase in annualized growth velocity as measured by standing height of at least 40% above baseline in said subject.
13. The method of claim 9 , wherein the increase in growth velocity is assessed by measuring standing height, sitting height, weight, head circumference, upper arm length, lower arm length, upper leg length, lower leg length, hand length or foot length.
14. The method of claim 9 , wherein said composition is administered once daily.
15. The method of claim 14 , wherein said composition is administered once daily over a period of at least 6 months.
16. The method of claim 14 , wherein said composition is administered once daily over a period of at least 12 months.
17. The method of claim 9 wherein said composition is administered daily, 3 times weekly, twice weekly, once weekly, or once every two weeks.
18. The method of claim 9 , wherein the composition is administered subcutaneously.
19. The method of claim 9 wherein said composition is administered parenterally.
20. The method of claim 9 comprising the step of administering said composition comprising said CNP variant peptide to said subject in an amount of at least 15 μg/kg per day, at least 30 μg/kg or at least 60 μg/kg per day of said CNP variant peptide.
21. The method of claim 9 , wherein said citric acid monohydrate is present at a concentration of from about 0.15 mg/ml to about 0.40 mg/ml, said sodium citrate dihydrate is present at a concentration of from about 0.5 mg/ml to about 1.5 mg/ml, said trehalose dihydrate is present at a concentration of from about 30 mg/ml to about 70 mg/ml, said D-mannitol is present at a concentration of from about 10 mg/ml to about 20 mg/ml, said L-methionine is present at a concentration of from about 0.5 mg/ml to about 1.5 mg/ml and said polysorbate 80 is present at a concentration of from about 0.01 mg/ml to about 0.1 mg/ml.
22. The method of claim 9 , wherein said citric acid monohydrate is present at a concentration of about 0.28 mg/ml, said sodium citrate dihydrate is present at a concentration of about 1.08 mg/ml, said trehalose dihydrate is present at a concentration of about 58.01 mg/ml, said D-mannitol is present at a concentration of about 15 mg/ml, said L-methionine is present at a concentration of about 0.73 mg/ml and said polysorbate 80 is present at a concentration of about 0.05 mg/ml.
23. The method of claim 9 that does not cause an adverse event of grade two or higher.
24. The method of claim 9 that results in no clinically significant change in blood hemoglobin concentration, blood platelet number, blood electrolyte concentration, blood urea nitrogen concentration, blood creatinine concentration, blood alkaline phosphatase concentration, blood alanine amino transferase concentration or blood aspartate aminotransferase concentration in said subject.
25. The method of claim 9 that results in a change in the upper body length to lower body length ratio of between −0.05 and 0.05.
26. The method of claim 9 that results in a change in the upper arm length to forearm length ratio of between −0.05 to 0.05.
27. The method of claim 9 that results in a change in the upper leg length to lower leg length ratio of between −0.05 and 0.05.