Antibody specific for CD22 and methods of use thereof
The present disclosure provides antibodies specific for an epitope present on CD22. The antibodies are useful in various treatment, diagnostic, and monitoring applications, which are also provided.
1. An antibody that specifically binds an epitope in CD22, wherein the antibody comprises:
a) an immunoglobulin heavy chain comprising a VH region having the amino acid sequence: EVQLVESGGGLVKPGGSLX 1 LSCAASGFAFSIYDMSWVRQAPGKGLEWVAYISSGGGTTYYPDTVKGRFTISRDNAKN X 2 LYLQMX 3 SLRAEDTAMYYCARHSGYGSSYGVLFAYWGQGTLVTVSS (SEQ ID NO: 1), where X 1 is K or R; X 2 is S or T; and X 3 is N or S; and
b) an immunoglobulin light chain comprising a VL region having the amino acid sequence:
DIQMTQSPSSX 1 SASVGDRVTITCRASQDISNYLNWYQQKPGKAX 2 KLLIYYTSILHSGVPSRFSGSGSGTD YTLTISSLQX 3 EDFATYFCQQGNTLPWTFGGGTKVEIK (SEQ ID NO: 2), where X 1 is L or V; X 2 is V or P; and
X 3 is Q or P.
2. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 3 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 7.
3. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 3 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 8.
4. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 3 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 9.
5. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 4 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 7.
6. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 4 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 8.
7. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 4 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 9.
8. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 5 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 7.
9. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 5 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 8.
10. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 5 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 9.
11. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 6 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 7.
12. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 6 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 8.
13. The antibody of claim 1 , wherein the immunoglobulin heavy chain comprises the VH region having the amino acid sequence of SEQ ID NO: 6 and the immunoglobulin light chain comprises the VL region having the amino acid sequence of SEQ ID NO: 9.
14. The antibody of any claim 1 , wherein the light chain region and the heavy chain region are present in separate polypeptides.
15. The antibody of claim 1 , wherein the light chain region and the heavy chain region are present in a single polypeptide.
16. The antibody of claim 1 , wherein the antibody binds the epitope with an affinity of from about 107 M −1 to about 1012 M −1 .
17. The antibody of claim 1 , wherein the heavy chain region is of the isotype IgG1, IgG2, IgG3, or IgG4.
18. The antibody of claim 1 , wherein the antibody is detectably labeled.
19. The antibody of claim 1 , wherein the antibody is a Fv, scFv, Fab, F(ab′)2, or Fab′.
20. The antibody of claim 1 , wherein the antibody comprises a covalently linked non-peptide synthetic polymer.
21. The antibody of claim 1 , wherein the synthetic polymer is poly(ethylene glycol) polymer.
22. The antibody of claim 1 , wherein the antibody comprises a covalently linked lipid or fatty acid moiety.
23. The antibody of claim 1 , wherein the antibody comprises a covalently linked polysaccharide or carbohydrate moiety.
24. The antibody of claim 1 , wherein the antibody comprises a contrast agent.
25. The antibody of claim 1 , wherein the antibody comprises an affinity domain.
26. The antibody of claim 1 , wherein the antibody is immobilized on a solid support.
27. The antibody of claim 1 , wherein the antibody is a single chain Fv (scFv) antibody.
28. A pharmaceutical composition comprising:
a) the antibody of claim 1 ; and
b) a pharmaceutically acceptable carrier.
29. A pharmaceutical composition comprising:
a) the antibody of claim 8 ; and
b) a pharmaceutically acceptable carrier.
30. A pharmaceutical composition comprising:
a) the antibody of claim 9 ; and
b) a pharmaceutically acceptable carrier.
31. A pharmaceutical composition comprising:
a) the antibody of claim 13 ; and
b) a pharmaceutically acceptable carrier.
32. A method of treating a B cell malignancy in a subject, the method comprising:
administering to a subject having cancer an effective amount of the pharmaceutical composition of claim 28 .
33. A method of treating a B cell malignancy in a subject, the method comprising:
administering to a subject having cancer an effective amount of the pharmaceutical composition of claim 29 .
34. A method of treating a B cell malignancy in a subject, the method comprising:
administering to a subject having cancer an effective amount of the pharmaceutical composition of claim 30 .
35. A method of treating a B cell malignancy in a subject, the method comprising:
administering to a subject having cancer an effective amount of the pharmaceutical composition of claim 31 .