IP Library › Granted Patent US 12,194,095
Granted Patent B2
US 12,194,095 · App. 17/545,274 · Granted Jan 14, 2025

Combinations and uses thereof

Inventors: Jan Endell (Munich, DE); Mark Winderlich (Munich, DE); Rainer Boxhammer (Aying, DE)
Assignee: Incyte Corporation
A61K39/39558A61K39/395A61P35/02C07D403/12C07D473/16C07K16/2803A61K2300/00C07K2317/565C07K2317/73
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,194,095
App. No.
17/545,274
Granted
Jan 14, 2025
Kind
B2
Abstract

The present disclosure describes a pharmaceutical combination of an anti-CD19 antibody and a phosphoinositide 3-kinase inhibitor for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.

Claims (106)

1. A method for treatment of non-Hodgkin's lymphoma in a patient in need thereof, said method comprising administering to the patient idelalisib and an antibody specific for CD19,

wherein said antibody comprises:

a variable heavy chain of the sequence

(SEQ ID NO: 10)

EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGY

INPYNDGTKYNEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGT

YYYGTRVFDYWGQGTLVTVSS;

a variable light chain of the sequence

(SEQ ID NO: 11)

DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQ

LLIYRMSNLNSGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYP

ITFGAGTKLEIK;

a heavy chain constant domain of the sequence

(SEQ ID NO: 12)

ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV

HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP

KSCDKTHTCPPCPAPELLGGPDVFLFPPKPKDTLMISRTPEVTCVVVDVS

HEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGK

EYKCKVSNKALPAPEEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTC

LVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRW

QQGNVFSCSVMHEALHNHYTQKSLSLSPGK;

and

a light chain constant domain of the sequence

(SEQ ID NO: 13)

RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG

NSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT

KSFNRGEC.

2. The method of claim 1 , wherein said antibody specific for CD19 and idelalisib are administered separately.

3. The method of claim 1 , wherein said antibody specific for CD19 and idelalisib are administered separately physically.

4. The method of claim 1 , wherein said antibody specific for CD19 and idelalisib are administered separately in time.

5. The method of claim 1 , wherein said antibody specific for CD19 and idelalisib are administered together.

6. The method of claim 1 , wherein idelalisib is administered prior to administration of the antibody specific for CD19.

7. The method of claim 1 , wherein idelalisib is administered after administration of the antibody specific for CD19.

8. The method of claim 1 , wherein the non-Hodgkin's lymphoma is follicular lymphoma.

9. The method of claim 1 , wherein the non-Hodgkin's lymphoma is small lymphocytic lymphoma.

10. The method of claim 1 , wherein the non-Hodgkin's lymphoma is mucosa-associated lymphoid tissue lymphoma.

11. The method of claim 1 , wherein the non-Hodgkin's lymphoma is marginal zone lymphoma.

12. The method of claim 1 , wherein the non-Hodgkin's lymphoma is diffuse large B cell lymphoma.

13. The method of claim 1 , wherein the non-Hodgkin's lymphoma is Burkitt's lymphoma.

14. The method of claim 1 , wherein the non-Hodgkin's lymphoma is mantle cell lymphoma.

15. A method for treatment of chronic lymphocytic leukemia in a patient in need thereof, said method comprising administering to the patient idelalisib and an antibody specific for CD19,

wherein said antibody comprises:

a variable heavy chain of the sequence

(SEQ ID NO: 10)

EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGY

INPYNDGTKYNEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGT

YYYGTRVFDYWGQGTLVTVSS;

a variable light chain of the sequence

(SEQ ID NO: 11)

DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQ

LLIYRMSNLNSGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYP

ITFGAGTKLEIK;

a heavy chain constant domain of the sequence

(SEQ ID NO: 12)

ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV

HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP

KSCDKTHTCPPCPAPELLGGPDVFLFPPKPKDTLMISRTPEVTCVVVDVS

HEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGK

EYKCKVSNKALPAPEEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTC

LVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRW

QQGNVFSCSVMHEALHNHYTQKSLSLSPGK;

and

a light chain constant domain of the sequence

(SEQ ID NO: 13)

RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG

NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK

SFNRGEC.

16. The method of claim 15 , wherein said antibody specific for CD19 and idelalisib are administered separately.

17. The method of claim 15 , wherein said antibody specific for CD19 and idelalisib are administered separately physically.

18. The method of claim 15 , wherein said antibody specific for CD19 and idelalisib are administered separately in time.

19. The method of claim 15 , wherein said antibody specific for CD19 and idelalisib are administered together.

20. The method of claim 15 , wherein idelalisib is administered prior to administration of the antibody specific for CD19.

21. The method of claim 15 , wherein idelalisib is administered after administration of the antibody specific for CD19.

22. A method for treatment of acute lymphoblastic leukemia in a patient in need thereof, said method comprising administering to the patient idelalisib and an antibody specific for CD19,

wherein said antibody comprises:

a variable heavy chain of the sequence

(SEQ ID NO: 10)

EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGY

INPYNDGTKYNEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGT

YYYGTRVFDYWGQGTLVTVSS;

a variable light chain of the sequence

(SEQ ID NO: 11)

DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQ

LLIYRMSNLNSGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYP

ITFGAGTKLEIK;

a heavy chain constant domain of the sequence

(SEQ ID NO: 12)

ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV

HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP

KSCDKTHTCPPCPAPELLGGPDVFLFPPKPKDTLMISRTPEVTCVVVDVS

HEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGK

EYKCKVSNKALPAPEEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTC

LVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRW

QQGNVFSCSVMHEALHNHYTQKSLSLSPGK;

and

a light chain constant domain of the sequence

(SEQ ID NO: 13)

RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG

NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK

SFNRGEC.

23. The method of claim 22 , wherein said antibody specific for CD19 and idelalisib are administered separately.

24. The method of claim 22 , wherein said antibody specific for CD19 and idelalisib are administered separately physically.

25. The method of claim 22 , wherein said antibody specific for CD19 and idelalisib are administered separately in time.

26. The method of claim 22 , wherein said antibody specific for CD19 and idelalisib are administered together.

27. The method of claim 22 , wherein idelalisib is administered prior to administration of the antibody specific for CD19.

28. The method of claim 22 , wherein idelalisib is administered after administration of the antibody specific for CD19.

Assignments (2)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 22, 2024
From: MORPHOSYS AG; MORPHOSYS US INC.
To: INCYTE CORPORATION
Reel/Frame 066645/0172 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Dec 16, 2021
From: ENDELL, JAN; WINDERLICH, MARK; BOXHAMMER, RAINER
To: MORPHOSYS AG.
Reel/Frame 058407/0955 →
Priority Claims (1)
EP 15181925 · Aug 21, 2015 · regional
Continuity (2)
Continuation 15752009
Related Publication 20220088197A1 · Mar 24, 2022
References Cited (101)
US 4708871A · Geysen · 1987 [cited by applicant]
US 5686072A · Uhr et al. · 1997 [cited by applicant]
US 6800620B2 · Sadhu et al. · 2004 [cited by applicant]
US 7109304B2 · Hansen et al. · 2006 [cited by applicant]
US 7902338B2 · Hansen et al. · 2011 [cited by applicant]
US 7968687B2 · McDonagh et al. · 2011 [cited by applicant]
US 8097703B2 · Rao-Naik et al. · 2012 [cited by applicant]
US 8323653B2 · Damschroder et al. · 2012 [cited by applicant]
US 8524867B2 · Bernett et al. · 2013 [cited by applicant]
US RE44599E · Fowler et al. · 2013 [cited by applicant]
US RE44638E · Fowler et al. · 2013 [cited by applicant]
US 8679492B2 · Blein et al. · 2014 [cited by applicant]
US 8691952B2 · Super et al. · 2014 [cited by applicant]
US 8865730B2 · Carra et al. · 2014 [cited by applicant]
US 8980901B2 · Fowler et al. · 2015 [cited by applicant]
US 11224654B2 · Endell et al. · 2022 [cited by applicant]
US 20080152649A1 · Chamberlain · 2008 [cited by examiner]
US 20100272723A1 · Bernett · 2010 [cited by examiner]
US 20120128586A1 · Calissano et al. · 2012 [cited by applicant]
US 20130209496A1 · Lewis et al. · 2013 [cited by applicant]
US 20140227277A1 · Amersdorffer et al. · 2014 [cited by applicant]
US 20140255427A1 · Amersdorffer et al. · 2014 [cited by applicant]
US 20180228893A1 · Endell et al. · 2018 [cited by applicant]
CN 103703027 · 2014 [cited by applicant]
CN 103732252 · 2014 [cited by applicant]
JP 2014525925 · 2014 [cited by applicant]
JP 2014525926 · 2014 [cited by applicant]
WO 200222212 · 2002 [cited by applicant]
WO WO2003048731 · 2003 [cited by applicant]
WO 2005012493 · 2005 [cited by applicant]
WO 2007002223 · 2007 [cited by applicant]
WO 2007076950 · 2007 [cited by applicant]
WO 2008022152 · 2008 [cited by applicant]
WO 2008031056 · 2008 [cited by applicant]
WO 2008150494 · 2008 [cited by applicant]
WO 2009052431 · 2009 [cited by applicant]
WO 2010053716 · 2010 [cited by applicant]
WO 2010095031 · 2010 [cited by applicant]
WO 2010151341 · 2010 [cited by applicant]
WO 2011147834 · 2011 [cited by applicant]
WO 2012010561 · 2012 [cited by applicant]
WO 2012010562 · 2012 [cited by applicant]
WO 2012156455 · 2012 [cited by applicant]
WO 2013024095 · 2013 [cited by applicant]
WO 2013024097 · 2013 [cited by applicant]
WO WO2014071109 · 2014 [cited by applicant]
WO WO2015195498 · 2015 [cited by applicant]
WO WO2016189014 · 2016 [cited by applicant]
WO WO2017207574 · 2017 [cited by applicant]
WO WO2018002031 · 2018 [cited by applicant]
WO WO2018078123 · 2018 [cited by applicant]
WO WO2018220040 · 2018 [cited by applicant]
WO WO2020055040 · 2020 [cited by applicant]
WO WO2020225196 · 2020 [cited by applicant]
WO WO2021084062 · 2021 [cited by applicant]
WO WO2021084063 · 2021 [cited by applicant]
WO WO2021084064 · 2021 [cited by applicant]
WO WO2021259902 · 2021 [cited by applicant]
WO WO2022115762 · 2022 [cited by applicant]
WO WO2022117799 · 2022 [cited by applicant]
WO WO2023118395 · 2023 [cited by applicant]
Keating (Targ Oncol, 10: 141-151, Feb. 2015). [cited by examiner]
Anderson et al. “Expression of human B cell-associated antigens on leukemias and lymphomas: a model of human B cell differentiation” Blood 1984 63:1424-1433. [cited by applicant]
Grossbard et al. “Anti-B4-blocked ricin: a phase II trial of 7 day continuous infusion in patients with multiple myeloma” Br. J. Haematol 1998 102:509-515. [cited by applicant]
Kalos et al. “T cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia” Science Translational Medicine 2011 3(95):1-11. [cited by applicant]
Loken et al. “Flow cytometric analysis of human bone marrow. II. Normal B lymphocyte development” Blood 1987 70:1316-1324. [cited by applicant]
Nadler et al. “B4, a human B lymphocyte-associated antigen expressed on normal, mitogen-activated, and malignant B lymphocytes” J. Immunol 1983 131:244-250. [cited by applicant]
Rickels et al. “Drug synergies observed for antibody and toxin components of SAR3419 ADC contribute to overall conjugate efficacy and can be combination drug or tumor cell line dependent” Abstract 4765 of the AACR Annua… [cited by applicant]
Sadelain et al. “The promise and potential pitfalls of chimeric antigen receptors” Current Opinion in Immunology 2009 21:215-223. [cited by applicant]
Scheuermann et al. “CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy” Leukemia and Lymphoma 1995 18:385-397. [cited by applicant]
Treon et al. “Expression of serotherapy target antigens in Waldenstrom's macroglobulinemia: therapeutic applications and considerations” Semin Oncol 2003 30:248-252. [cited by applicant]
Uckun et al. “Detailed studies on expression and function of CD19 surface determinant by using B43 monoclonal antibody and the clinical potential of anti-CD19 immunotoxins” Blood 1988 71:13-29. [cited by applicant]
International Search Report and Written Opinion in PCT/EP2016/069571 dated Dec. 2, 2016. [cited by applicant]
International Preliminary Report on Patentability in PCT/EP2016/069571 dated Feb. 27, 2018. [cited by applicant]
Extended European Search Report in 15181925.7 dated Feb. 15, 2016. [cited by applicant]
Miller et al. “FDA Approval: Idelalisib Monotherapy for the Treatment of Patients with Follicular Lymphoma and Small Lymphocytic Lymphoma” Clin. Cancer Res. 2015 21(7) : 1525-9. [cited by applicant]
Yang et al. “Idelalisib: First-in-Class P13K Delta Inhibitor for the Treatment of Chronic Lymphocytic Leukemia, Small Lymphocytic Leukemia, and Follicular Leukemia” Clin. Cancer Res. 2015 21 (7) : 1537-42. [cited by applicant]
Office Communication dated Mar. 31, 2020 in USSN 15/752,009 filed Feb. 12, 2018. [cited by applicant]
Office Communication dated Oct. 14, 2020 in USSN 15/752,009 filed Feb. 12, 2018. [cited by applicant]
Office Communication dated Apr. 22, 2021 in USSN 15/752,009 filed Feb. 12, 2018. [cited by applicant]
Office Communication dated Jul. 9, 2021 in USSN 15/752,009 filed Feb. 12, 2018. [cited by applicant]
Office Communication dated Sep. 8, 2021 in USSN 15/752,009 filed Feb. 12, 2018. [cited by applicant]
Office Communication dated Sep. 22, 2021 in USSN 15/752,009 filed Feb. 12, 2018. [cited by applicant]
Awan et al., “CD19 targeting of chronic lymphocytic leukemia with a novel Fc-domain—engineered monoclonal antibody,” Blood, Feb. 11, 2010, 115(6):1204-1213. [cited by applicant]
Chothia et al., “Canonical structures for the hypervariable regions of immunoglobulins,” Journal of Molecular Biology, 1987, 196(4):901-917. [cited by applicant]
Chou et al., “Quantitative analysis of dose-effect relationships: the combined effects of multiple drugs or enzyme inhibitors,” Advances in Enzyme Regulation, 1984, 22:27-55. [cited by applicant]
Chou et al., “Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies,” Pharmacological Reviews, Sep. 2006, 58(3):621-681. [cited by applicant]
Clarke et al., “Issues in experimental design and endpoint analysis in the study of experimental cytotoxic agents in vivo in breast cancer and other models,” Breast Cancer Research and Treatment, 1997, 46:255-278. [cited by applicant]
Geysen et al., “A priori delineation of a peptide which mimics a discontinuous antigenic determinant,” Molecular Immunology, 1986, 23(7):709-715. [cited by applicant]
Geysen et al., “Small peptides induce antibodies with a sequence and structural requirement for binding antigen comparable to antibodies raised against the native protein,” Proceedings of the National Academy of Science… [cited by applicant]
Geysen et al., “Use of peptide synthesis to probe viral antigens for epitopes to a resolution of a single amino acid,” Proceedings of the National Academy of Sciences of the USA, 1984, 8:3998-4002. [cited by applicant]
Gockeritz et al., “Efficacy of phosphatidylinositol-3 kinase inhibitors with diverse isoform selectivity profiles for inhibiting the survival of chronic lymphocytic leukemia cells,” International Journal of Cancer, Nov.… [cited by applicant]
Hopp et al., “Prediction of protein antigenic determinants from amino acid sequences,” Proceedings of the National Academy of Sciences of the USA, 1981, 78(6):3824-3828. [cited by applicant]
Horton et al., “Potent in vitro and in vivo activity of an Fc-engineered anti-CD19 monoclonal antibody against lymphoma and leukemia,” Cancer Research, Oct. 1, 2008, 68(19):8049-8057. [cited by applicant]
IMGT.org, “Protein display: Human IGH C-Regions,” last updated Jun. 16, 2020 [retrieved on Mar. 23, 2021], retrieved from URL <http://www.imgt.org/IMGTrepertoire/Proteins/protein/human/IGH/IGHC/Hu_IGHCallgenes.html>, 2 … [cited by applicant]
Kyte et al., “A simple method for displaying the hydropathic character of a protein,” Journal of Molecular Biology, 1982, 157:105-132. [cited by applicant]
Robak, “Current and emerging monoclonal antibody treatments for chronic lymphocytic leukemia: state of the art,” Expert Review of Hematology, 2014, 7(6):841-857. [cited by applicant]
Robak, “New Therapies for Chronic Lymphocytic Leukemia,” Current Cancer Therapy Reviews, 2013, 9(4):245-257 (Abstract Only). [cited by applicant]
Savchenko et al., “Clinical Recommendations by examination and treatment of patients with chronic lymphocytic leukemia,” National Hematological Society Russian Professional Society of Oncohematologists, Apr. 2014, 46 pa… [cited by applicant]
Woyach et al., “A phase 1 trial of the Fc-engineered CD19 antibody XmAb5574 (MOR00208) demonstrates safety and preliminary efficacy in relapsed CLL,” Blood, Dec. 4, 2014, 124(24):3553-3560. [cited by applicant]
Wu et al., “Novel Agents for Chronic Lymphocytic Leukemia,” Journal of Hematology & Oncology, 2013, 6(36): 1-8. [cited by applicant]
Cited By (1)
US 12,631,639