Engineered chimeric fusion protein compositions and methods of use thereof
Compositions and methods for making and using engineered cells, such as, engineered myeloid cells that express a chimeric fusion protein that has a binding domain capable to binding surface molecules on target cells such as diseased cells.
1. A method of treating a TROP2-expressing cancer in a subject in need thereof, comprising: administering to the subject a therapeutically effective amount of a composition comprising a recombinant polynucleic acid encapsulated by a nanoparticle delivery vehicle, wherein the recombinant polynucleic acid comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising:
(a) an extracellular domain comprising an anti-TROP2 binding domain, and
(b) a transmembrane domain operatively linked to the extracellular domain;
wherein the transmembrane domain is a transmembrane domain from a protein that dimerizes with endogenous FcR-gamma receptors expressed in myeloid cells, monocytes or macrophages of the subject;
wherein the CFP is expressed on the surface of myeloid cells of the subject that express endogenous FcR-gamma receptors;
wherein the anti-TROP2 binding domain comprises a Fab fragment or an scFv domain comprising a heavy chain variable domain and a light chain variable domain on a single polypeptide chain linked via a linker; and
wherein the anti-TROP2 binding domain comprises (a) a heavy chain complementarity determining region 1 (HC CDR1), a HC CDR2 and a HC CDR3 of SEQ ID NO: 34 and a light chain complementarity determining region 1 (LC CDR1), a LC CDR2 and a LC CDR3 of SEQ ID NO: 34; or (b) a HC CDR1, a HC CDR2 and a HC CDR3 of SEQ ID NO: 35 and a LC CDR1, a LC CDR2 and a LC CDR3 of SEQ ID NO: 35.
2. The method of claim 1 , wherein the extracellular domain further comprises an extracellular domain from CD16a, CD64, CD68 or CD89 or a fragment thereof.
3. The method of claim 1 , wherein after administration of the composition to a human subject the CFP is preferentially or specifically expressed in myeloid cells, monocytes or macrophages of the human subject.
4. The method of claim 1 , wherein the transmembrane domain is a transmembrane domain from CD16a, CD64, CD68 or CD89.
5. The method of claim 1 , wherein the CFP further comprises an intracellular domain comprising one or more intracellular signaling domains, wherein the one or more intracellular signaling domains comprises an intracellular signaling domain from CD16a, CD64, CD68, CD89, FCERIG, CD40 or CD3 zeta.
6. The method of claim 1 , wherein the recombinant polynucleic acid is an mRNA.
7. The method of claim 1 , wherein the anti-TROP2 binding domain comprises a sequence selected from the group consisting of SEQ ID NO: 34 and 35.
8. The method of claim 1 , wherein the CFP is not substantially expressed on the surface of T cells of the subject.
9. The method of claim 1 , wherein the nanoparticle delivery vehicle comprises a lipid nanoparticle.
10. The method of claim 9 , wherein the lipid nanoparticle comprises a polar lipid and a non-polar lipid.
11. The method of claim 9 , wherein the lipid nanoparticle comprises a cationic lipid, a non-cationic lipid, a neutral lipid, or a PEGylated lipid.
12. The method of claim 9 , wherein the lipid nanoparticle is from 100 to 300 nm in diameter.
13. A method of treating a TROP2-expressing cancer in a subject in need thereof, comprising: administering to the subject a therapeutically effective amount of a composition comprising a recombinant polynucleic acid encapsulated by a nanoparticle delivery vehicle, wherein the recombinant polynucleic acid comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising:
(a) an extracellular domain comprising an anti-TROP2 binding domain, and
(b) a transmembrane domain operatively linked to the extracellular domain;
wherein the transmembrane domain is a transmembrane domain from a protein that dimerizes with endogenous FcR-gamma receptors expressed in myeloid cells, monocytes or macrophages of the subject;
wherein the CFP is expressed on the surface of myeloid cells of the subject that express endogenous FcR-gamma receptors;
wherein the extracellular domain further comprises an extracellular domain from CD16a, CD64, CD68 or CD89; wherein the extracellular domain from CD16a, CD64, CD68 or CD89 comprises an amino acid sequence of IHQDYTTQN (SEQ ID NO: 82).
14. A method of treating a TROP2-expressing cancer in a subject in need thereof, comprising: administering to the subject a therapeutically effective amount of a composition comprising a recombinant polynucleic acid encapsulated by a nanoparticle delivery vehicle, wherein the recombinant polynucleic acid comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising:
(a) an extracellular domain comprising an anti-TROP2 binding domain, and
(b) a transmembrane domain operatively linked to the extracellular domain;
wherein the transmembrane domain is a transmembrane domain from a protein that dimerizes with endogenous FcR-gamma receptors expressed in myeloid cells, monocytes or macrophages of the subject;
wherein the CFP is expressed on the surface of myeloid cells of the subject that express endogenous FcR-gamma receptors;
wherein the transmembrane domain is a transmembrane domain from CD16a, CD64, CD68 or CD89; and
wherein the transmembrane domain from CD16a, CD64, CD68 or CD89 comprises an amino acid sequence of LIRMAVAGLVLVALLAILV (SEQ ID NO: 83).
15. The method of claim 14 , wherein the CFP further comprises a signal peptide sequence.
16. The method of claim 15 , wherein the signal peptide sequence is MWLQSLLLLGTVACSIS (SEQ ID NO: 7).
17. The method of claim 14 , wherein the anti-TROP2 binding domain comprises a Fab fragment, or an scFv domain or an sdAb domain.
18. The method of claim 17 , wherein the anti-TROP2 binding domain comprises a heavy chain variable domain and a light chain variable domain on a single polypeptide chain and linked via a linker, comprising (a) a heavy chain complementarity determining region 1 (HC CDR1), a HC CDR2 and a HC CDR3 of SEQ ID NO: 34 and a light chain complementarity determining region 1 (LC CDR1), a LC CDR2 and a LC CDR3 of SEQ ID NO: 34; or (b) a HC CDR1, a HC CDR2 and a HC CDR3 of SEQ ID NO: 35 and a LC CDR1, a LC CDR2 and a LC CDR3 of SEQ ID NO: 35.
19. The method of claim 14 , wherein the extracellular domain further comprises an extracellular domain from CD16a, CD64, CD68 or CD89.
20. A method of treating a TROP2-expressing cancer in a subject in need thereof, comprising: administering to the subject a therapeutically effective amount of a composition comprising a recombinant polynucleic acid encapsulated by a nanoparticle delivery vehicle, wherein the recombinant polynucleic acid comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising:
(a) an extracellular domain comprising an anti-TROP2 binding domain, and
(b) a transmembrane domain operatively linked to the extracellular domain;
wherein the transmembrane domain is a transmembrane domain from a protein that dimerizes with endogenous FcR-gamma receptors expressed in myeloid cells, monocytes or macrophages of the subject;
wherein the CFP is expressed on the surface of myeloid cells of the subject that express endogenous FcR-gamma receptors;
wherein the transmembrane domain is a transmembrane domain from CD16a, CD64, CD68 or CD89; and
wherein the intracellular domain comprises an amino acid sequence of ENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK (SEQ ID NO: 84).
21. A method of treating a TROP2-expressing cancer in a subject in need thereof, comprising: administering to the subject a therapeutically effective amount of a composition comprising a recombinant polynucleic acid encapsulated by a nanoparticle delivery vehicle, wherein the recombinant polynucleic acid comprises a sequence encoding a chimeric fusion protein (CFP), the CFP comprising:
(a) an extracellular domain comprising an anti-TROP2 binding domain, and
(b) a transmembrane domain operatively linked to the extracellular domain;
wherein the transmembrane domain is a transmembrane domain from a protein that dimerizes with endogenous FcR-gamma receptors expressed in myeloid cells, monocytes or macrophages of the subject;
wherein the CFP is expressed on the surface of myeloid cells of the subject that express endogenous FcR-gamma receptors; and
wherein the signal peptide sequence is a GMCSF signal peptide sequence.
22. A method of treating a TROP2-expressing cancer in a subject in need thereof, comprising: administering to the subject a therapeutically effective amount of a composition comprising a recombinant polynucleic acid encapsulated by a nanoparticle delivery vehicle, wherein the recombinant polynucleic acid comprises a sequence encoding a chimeric fusion protein (CFP), wherein the CFP comprises:
(i) an extracellular domain comprising:
(I) an anti-TROP2 binding domain comprising: an scFv having a heavy chain variable domain and a light chain variable domains on a single polypeptide chain linked via a linker, wherein the scFv comprises a sequence selected from the group consisting of SEQ ID NO: 34 and 35; and
(II) a hinge domain comprising an amino acid sequence of IHQDYTTQN (SEQ ID NO: 82);
(ii) a transmembrane domain having an amino acid sequence of LIRMAVAGLVLVALLAILV (SEQ ID NO: 83); and
(iii) an intracellular domain comprising an amino acid sequence of ENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK (SEQ ID NO: 84).