METHODS OF TREATING TUBERCULOSIS
The present disclosure relates to extracellular vesicles, e.g., exosomes, comprising a cytokine, e.g., Interleukin-12 (IL-12), and, optionally, a TB antigen. Also provided herein are methods of inducing an immune response against Mycobacterium tuberculosis in a subject in need thereof comprising administering an extracellular vesicle comprising a cytokine, e.g., IL-12, and, optionally, a TB antigen.
1 . A method of inducing an immune response against Mycobacterium tuberculosis in a subject in need thereof comprising administering an extracellular vesicle (EV) comprising Interleukin-12 (IL-12).
2 . The method of claim 1 , wherein the immune response is against one or more epitopes of Mycobacterium tuberculosis.
3 . The method of claim 1 or 2 , wherein the immune response is a cellular immune response, a humoral immune response, or both cellular and humoral immune responses.
4 . The method of claim 3 , wherein the induction of the cellular immune response, the humoral immune response, or both cellular and humor immune responses of the EV is increased by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100% or more, compared to IL-12 without an EV.
5 . The method of any one of claims 1 to 4 , wherein the immune response is a CD4 T cell response, a CD8 T cell response, or both CD4 and CD8 T cell responses.
6 . The method of any one of claims 2 to 5 , wherein the epitope is an ESAT6 antigen, a TB10.4 antigen, or both ESAT6 antigen and TB10.4 antigen.
7 . The method of claim 6 , wherein the immune response is CD4 T-cell immune response with effector function that is specific to the ESAT6 antigen.
8 . The method of claim 6 or 7 , wherein the immune response is CD8 T-cell immune response that is specific to the TB10.4 antigen.
9 . The method of any one of claims 6 to 8 , wherein the ESAT6 antigen comprises an epitope having at least three amino acids, at least four amino acids, at least five amino acids, at least six amino acids, at least seven amino acids, at least eight amino acids, at least nine amino acids, at least ten amino acids, at least eleven amino acids, at least twelve amino acids, at least thirteen amino acids, at least fourteen amino acids, at least fifteen amino acids of the amino acid sequence as set forth in
(SEQ ID NO: 370)
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSE
AYQGVQQKWDATATELNN ALQNLARTISEAGQAMASTEGNVTGMFA.
10 . The method of any one of claims 6 to 9 , wherein the TB10.4 antigen comprises an epitope having at least three amino acids, at least four amino acids, at least five amino acids, at least six amino acids, at least seven amino acids, at least eight amino acids, at least nine amino acids, at least ten amino acids, at least eleven amino acids, at least twelve amino acids, at least thirteen amino acids, at least fourteen amino acids, at least fifteen amino acids of the amino acid sequence as set forth in
(SEQ ID NO: 371)
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGI
TYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG.
11 . The method of any one of claims 1 to 10 , wherein the EV further comprises a TB antigen.
12 . An extracellular vesicle (EV) comprising IL-12 and a TB antigen.
13 . The EV of claim 12 , wherein the EV induces an immune response against Mycobacterium tuberculosis in a subject in need thereof.
14 . The EV of claim 13 , wherein the immune response is against one or more epitopes of Mycobacterium tuberculosis.
15 . The EV of claim 13 or 14 , wherein the immune response is a cellular immune response, a humoral immune response, or both cellular and humoral immune responses.
16 . The EV of any one of claims 13 to 15 , wherein the induction of the cellular immune response, the humoral immune response, or both cellular and humor immune responses of the EV is increased by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100% or more, compared to IL-12 without an EV.
17 . The EV of any one of claims 13 to 16 , wherein the immune response is a CD4 T cell response, a CD8 T cell response, or both CD4 and CD8 T cell responses.
18 . The EV of any one of claims 14 to 17 , wherein the epitope is an ESAT6 antigen, a TB10.4 antigen, or both ESAT6 antigen and TB10.4 antigen.
19 . The EV of any one of claims 14 to 18 , wherein the immune response is CD4 T-cell immune response with effector function that is specific to the ESAT6 antigen.
20 . The EV of claim 18 or 19 , wherein the immune response is CD8 T-cell immune response that is specific to the TB10.4 antigen.
21 . The EV of any one of claims 18 to 20 , wherein the ESAT6 antigen comprises an epitope having at least three amino acids, at least four amino acids, at least five amino acids, at least six amino acids, at least seven amino acids, at least eight amino acids, at least nine amino acids, at least ten amino acids, at least eleven amino acids, at least twelve amino acids, at least thirteen amino acids, at least fourteen amino acids, at least fifteen amino acids of the amino acid sequence as set forth in
(SEQ ID NO: 370)
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSE
AYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA.
22 . The EV of any one of claims 18 to 21 , wherein the TB10.4 antigen comprises an epitope having at least three amino acids, at least four amino acids, at least five amino acids, at least six amino acids, at least seven amino acids, at least eight amino acids, at least nine amino acids, at least ten amino acids, at least eleven amino acids, at least twelve amino acids, at least thirteen amino acids, at least fourteen amino acids, at least fifteen amino acids of the amino acid sequence as set forth in
(SEQ ID NO: 371)
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGI
TYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG.
23 . The method of claim 11 or the EV of any one of claims 18 to 22 , wherein the TB antigen is identical to the ESAT6 antigen or the TB10.4 antigen.
24 . The method of any one of claims 1 to 12 and 23 or the EV of any one of claims 12 to 23 , wherein the EV further comprises a scaffold moiety.
25 . The method or EV of claim 24 , wherein the IL-12 is linked to the scaffold moiety.
26 . The method or EV of claim 24 , wherein the TB antigen is further linked to the scaffold moiety.
27 . The method or EV of any one of claims 24 to 26 , wherein the EV further comprises a second scaffold moiety.
28 . The method or EV of claim 27 , wherein the IL-12 is linked to the scaffold moiety, and the TB antigen is linked to the second scaffold moiety.
29 . The method or EV of claim 27 or 28 , wherein the first scaffold moiety and the second scaffold moiety are the same.
30 . The method or EV of claim 27 or 28 , wherein the first scaffold moiety and the second scaffold moiety are different.
31 . The method or EV of any one of claims 25 to 30 , wherein the first scaffold moiety is a Scaffold X.
32 . The method or EV of any one of claims 25 to 30 , wherein the first scaffold moiety is a Scaffold Y.
33 . The method or EV of any one of claims 27 to 30 , wherein the second scaffold moiety is a Scaffold Y.
34 . The method or EV of any one of claims 27 to 30 , wherein the second scaffold moiety is a Scaffold X.
35 . The method or EV of claim 31 or 34 , wherein Scaffold X is a scaffold protein that is capable of anchoring the IL-12 and/or the TB antigen on the luminal surface of the EV and/or on the exterior surface of the EV.
36 . The method or EV of any one of claims 31 , 34 , and 35 , wherein Scaffold X is selected from the group consisting of prostaglandin F2 receptor negative regulator (the PTGFRN protein); basigin (the BSG protein); immunoglobulin superfamily member 2 (the IGSF2 protein); immunoglobulin superfamily member 3 (the IGSF3 protein); immunoglobulin superfamily member 8 (the IGSF8 protein); integrin beta-1 (the ITGB1 protein); integrin alpha-4 (the ITGA4 protein); 4F2 cell-surface antigen heavy chain (the SLC3A2 protein); a class of ATP transporter proteins (the ATP1A1, ATP1A2, ATP1A3, ATP1A4, ATP1B3, ATP2B1, ATP2B2, ATP2B3, ATP2B4 proteins), and any combination thereof.
37 . The method or EV of claim 36 , wherein the first scaffold moiety is PTGFRN protein.
38 . The method or EV of any one of claims 31 , 34 , and 35 , wherein the first scaffold moiety comprises an amino acid sequence as set forth in SEQ ID NO: 33.
39 . The method or EV of claim 37 or 38 , wherein the first scaffold moiety comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or about 100% identical to SEQ ID NO: 1.
40 . The method or EV of claim 32 or 33 , wherein Scaffold Y is a scaffold protein that is capable of anchoring the IL-12 and/or the TB antigen on the luminal surface of the EV.
41 . The method or EV of claim 40 , wherein the Scaffold Y is selected from the group consisting of myristoylated alanine rich Protein Kinase C substrate (the MARCKS protein); myristoylated alanine rich Protein Kinase C substrate like 1 (the MARCKSL1 protein); brain acid soluble protein 1 (the BASP1 protein), and any combination thereof.
42 . The method or EV of any one of claims 32 , 33 , or 40 , wherein the Scaffold Y is BASP1 protein.
43 . The method or EV of any one of claims 32 , 33 , or 40 to 42 , wherein the Scaffold Y comprises an N terminus domain (ND) and an effector domain (ED), wherein the ND and/or the ED are associated with the luminal surface of the EV.
44 . The method or EV of claim 43 , wherein the ND is associated with the luminal surface of the exosome via myristoylation.
45 . The method or EV of claim 43 or 44 , wherein the ED is associated with the luminal surface of the exosome by an ionic interaction.
46 . The method or EV of any one of claims 43 to 45 , wherein the ED comprises (i) a basic amino acid or (ii) two or more basic amino acids in sequence, wherein the basic amino acid is selected from the group consisting of Lys, Arg, His, and any combination thereof.
47 . The method or EV of claim 45 , wherein the basic amino acid is (Lys)n, wherein n is an integer between 1 and 10.
48 . The method or EV of any one of claims 43 to 47 , wherein the ED comprises Lys (K), KK, KKK, KKKK (SEQ ID NO: 205), KKKKK (SEQ ID NO: 206), Arg (R), RR, RRR, RRRR (SEQ ID NO: 207); RRRRR (SEQ ID NO: 208), KR, RK, KKR, KRK, RKK, KRR, RRK, (K/R)(K/R)(K/R)(K/R) (SEQ ID NO: 209), (K/R)(K/R)(K/R)(K/R)(K/R) (SEQ ID NO: 210), or any combination thereof.
49 . The method or EV of any one of claims 43 to 47 , wherein the ND comprises the amino acid sequence as set forth in G:X2:X3:X4:X5:X6, wherein G represents Gly; wherein “:” represents a peptide bond, wherein each of the X2 to the X6 is independently an amino acid, and wherein the X6 comprises a basic amino acid.
50 . The method or EV of claim 49 , wherein:
(i) the X2 is selected from the group consisting of Pro, Gly, Ala, and Ser;
(ii) the X4 is selected from the group consisting of Pro, Gly, Ala, Ser, Val, Ile, Leu, Phe, Trp, Tyr, Gln and Met;
(iii) the X5 is selected from the group consisting of Pro, Gly, Ala, and Ser;
(iv) the X6 is selected from the group consisting of Lys, Arg, and His; or
(v) any combination of (i)-(iv).
51 . The method or EV of any one of claims 43 to 47 , wherein the ND comprises the amino acid sequence of G:X2:X3:X4:X5:X6, wherein
(i) G represents Gly;
(ii) “:” represents a peptide bond;
(iii) the X2 is an amino acid selected from the group consisting of Pro, Gly, Ala, and Ser;
(iv) the X3 is an amino acid;
(v) the X4 is an amino acid selected from the group consisting of Pro, Gly, Ala, Ser, Val, Ile, Leu, Phe, Trp, Tyr, Gln and Met;
(vi) the X5 is an amino acid selected from the group consisting of Pro, Gly, Ala, and Ser; and
(vii) the X6 is an amino acid selected from the group consisting of Lys, Arg, and His.
52 . The method or EV of any one of claims 49 to 51 , wherein the X3 is selected from the group consisting of Asn, Gln, Ser, Thr, Asp, Glu, Lys, His, and Arg.
53 . The method or EV of any one of claims 43 to 52 , wherein the ND and the ED are joined by a linker.
54 . The method or EV of claim 53 , wherein the linker comprises one or more amino acids.
55 . The method of any one of claims 43 to 54 , wherein the ND comprises an amino acid sequence selected from the group consisting of (i) GGKLSKK (SEQ ID NO: 211), (ii) GAKLSKK (SEQ ID NO: 212), (iii) GGKQSKK (SEQ ID NO: 213), (iv) GGKLAKK (SEQ ID NO: 214), (v) GGKLSKK (SEQ ID NO: 211), or (vi) any combination thereof.
56 . The method or EV of claim 55 , wherein the ND comprises an amino acid sequence selected from the group consisting of (i) GGKLSKKK (SEQ ID NO: 238), (ii) GGKLSKKS (SEQ ID NO: 239), (iii) GAKLSKKK (SEQ ID NO: 240), (iv) GAKLSKKS (SEQ ID NO: 241), (v) GGKQSKKK (SEQ ID NO: 242), (vi) GGKQSKKS (SEQ ID NO: 243), (vii) GGKLAKKK (SEQ ID NO: 244), (viii) GGKLAKKS (SEQ ID NO: 245), (ix) GGKLSKKK (SEQ ID NO: 238), (x) GGKLSKKS (SEQ ID NO: 239), and (xi) any combination thereof.
57 . The method or EV of any one of claims 43 to 56 , wherein the ND comprises the amino acid sequence GGKLSKK (SEQ ID NO: 211).
58 . The method or EV of any one of claims 43 to 57 , wherein the Scaffold Y is at least about 8, at least about 9, at least about 10, at least about 11, at least about 12, at least about 13, at least about 14, at least about 15, at least about 16, at least about 17, at least about 18, at least about 19, at least about 20, at least about 21, at least about 22, at least about 23, at least about 24, at least about 25, at least about 30, at least about 35, at least about 40, at least about 45, at least about 50, at least about 55, at least about 60, at least about 65, at least about 70, at least about 75, at least about 80, at least about 85, at least about 90, at least about 95, at least about 100, at least about 105, at least about 110, at least about 120, at least about 130, at least about 140, at least about 150, at least about 160, at least about 170, at least about 180, at least about 190, or at least about 200 amino acids in length.
59 . The method or EV of claims 43 to 58 , wherein the Scaffold Y comprises (i) GGKLSKKKKGYNVN (SEQ ID NO: 246), (ii) GAKLSKKKKGYNVN (SEQ ID NO: 247), (iii) GGKQSKKKKGYNVN (SEQ ID NO: 248), (iv) GGKLAKKKKGYNVN (SEQ ID NO: 249), (v) GGKLSKKKKGYSGG (SEQ ID NO: 250), (vi) GGKLSKKKKGSGGS (SEQ ID NO: 251), (vii) GGKLSKKKKSGGSG (SEQ ID NO: 252), (viii) GGKLSKKKSGGSGG (SEQ ID NO: 253), (ix) GGKLSKKSGGSGGS (SEQ ID NO: 254), (x) GGKLSKSGGSGGSV (SEQ ID NO: 255), or (xi) GAKKSKKRFSFKKS (SEQ ID NO: 291).
60 . The method or EV of claims 43 to 58 , wherein the Scaffold Y consists of (i) GGKLSKKKKGYNVN (SEQ ID NO: 246), (ii) GAKLSKKKKGYNVN (SEQ ID NO: 247), (iii) GGKQSKKKKGYNVN (SEQ ID NO: 248), (iv) GGKLAKKKKGYNVN (SEQ ID NO: 249), (v) GGKLSKKKKGYSGG (SEQ ID NO: 250), (vi) GGKLSKKKKGSGGS (SEQ ID NO: 251), (vii) GGKLSKKKKSGGSG (SEQ ID NO: 252), (viii) GGKLSKKKSGGSGG (SEQ ID NO: 253), (ix) GGKLSKKSGGSGGS (SEQ ID NO: 254), (x) GGKLSKSGGSGGSV (SEQ ID NO: 255), or (xi) GAKKSKKRFSFKKS (SEQ ID NO: 291).
61 . The method or EV of claim 43 to 60 , wherein the Scaffold Y does not comprise Met at the N terminus.
62 . The method or EV of any one of claims 43 to 61 , wherein the Scaffold Y comprises a myristoylated amino acid residue at the N terminus of the scaffold protein.
63 . The method or EV of claim 62 , wherein the amino acid residue at the N terminus of the Scaffold Y is Gly.
64 . The method or EV of any one of claims 25 to 63 , wherein the IL-12 is linked to a scaffold moiety (e.g., Scaffold X) on the exterior surface of the EV, and the TB antigen is linked to the scaffold moiety on the luminal surface of the EV.
65 . The method or EV of any one of claims 25 to 63 , wherein the IL-12 is linked to a scaffold moiety (e.g., Scaffold X) on the luminal surface of the EV, and the TB antigen is linked to the scaffold moiety on the exterior surface of the EV.
66 . The method or EV of any one of claims 27 to 63 , wherein the TB antigen is linked to a scaffold moiety (e.g., Scaffold X) on the exterior surface of the EV, and the IL-12 is linked to a second scaffold moiety (e.g., Scaffold X) on the exterior surface of the EV.
67 . The method or EV of any one of claims 27 to 63 , wherein the TB antigen is linked to a scaffold moiety (e.g., Scaffold X) on the exterior surface of the EV, and the IL-12 is linked to a second scaffold moiety (e.g., Scaffold Y) on the luminal surface of the EV.
68 . The method or EV of any one of claims 27 to 63 , wherein the IL-12 is linked to a scaffold moiety (e.g., Scaffold X) on the exterior surface of the EV, and the TB antigen is linked to a second scaffold moiety (e.g., Scaffold X) on the exterior surface of the EV.
69 . The method or EV of any one of claims 27 to 63 , wherein the IL-12 is linked to a scaffold moiety (e.g., Scaffold X) on the exterior surface of the EV, and the TB antigen is linked to a second scaffold moiety (e.g., Scaffold Y) on the luminal surface of the EV.
70 . The method or EV of any one of claims 27 to 63 , wherein the IL-12 is linked to a scaffold moiety (e.g., Scaffold Y) on the luminal surface of the EV, and the TB antigen is linked to a second scaffold moiety (e.g., Scaffold Y) on the luminal surface of the EV.
71 . The method or EV of any one of claims 27 to 63 , wherein the IL-12 is linked to a scaffold moiety (e.g., Scaffold X) on the luminal surface of the EV, and the TB antigen is linked to a second scaffold moiety (e.g., Scaffold Y) on the luminal surface of the EV.
72 . The method or EV of any one of claims 25 to 71 , wherein the IL-12 and/or the TB antigen is linked to the scaffold moiety by a linker.
73 . The method or EV of any one of claims 25 to 31 , wherein the IL-12 and/or the TB antigen is linked to the second scaffold moiety by a linker.
74 . The method or EV of claim 72 or 73 , wherein the linker is a polypeptide.
75 . The method or EV of claim 72 or 73 , wherein the linker is a non-polypeptide moiety.
76 . The method of any one of claims 1 to 11 and 23 to 76 or EV of any one of claims 12 to 76 , wherein the EV is an exosome.
77 . A pharmaceutical composition comprising the EV of any one of claims 12 to 76 and a pharmaceutically acceptable carrier.
78 . A cell that produces the EV of any one of claims 12 to 76 .
79 . A cell comprising one or more vectors, wherein the vectors comprises a nucleic acid sequence encoding the TB antigen in any one of claims 12 to 76 , the IL-12 in any one of claims 12 to 76 .
80 . A kit comprising the EV of any one of claims 12 to 76 and instructions for use.
81 . A method of making EVs comprising culturing the cell of claim 78 or 79 under a suitable condition and obtaining the EVs.
82 . A method of inducing an immune response in a subject in need thereof comprising administering the EV of any one of claims 12 to 76 to the subject.
83 . A method of preventing or treating a disease in a subject in need thereof, comprising administering the EV of any one of claims 12 to 76 , wherein the disease is associated with the TB antigen.
84 . The method of claim 83 , wherein the disease is tuberculosis.
85 . The method of any one of claims 1 to 11 , 23 to 76 , and 82 to 84 , further comprising administering a TB antigen to the subject.
86 . The method of claim 85 , wherein the TB antigen is administered prior to, concurrently with, or after the administration of the EV.
87 . The method of claim 85 , wherein the subject is primed by the TB antigen.
88 . The method of any one of claims 1 to 11 , and 23 to 76 , and 82 to 87 , wherein the EV is administered parenterally, orally, intravenously, intramuscularly, intra-tumorally, intranasally, subcutaneously, or intraperitoneally.
89 . The method of any one of claims 1 to 11 , and 23 to 76 , and 82 to 88 , comprising administering an additional therapeutic agent.