METHODS OF EDITING A SINGLE NUCLEOTIDE POLYMORPHISM USING PROGRAMMABLE BASE EDITOR SYSTEMS
Described are compositions and methods for altering mutations associated with Rett Syndrome (RETT). Provided herein are compositions and methods of using base editors (e.g., ABE8) comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain in conjunction with a guide polynucleotide. Also provided herein are base editor systems for editing nucleobases of target nucleotide sequences.
1 . A method of editing a methyl CpG binding protein 2 (MECP2) gene or regulatory element thereof in a subject, the method comprising administering to a subject in need thereof (i) an adenosine base editor or a nucleic acid sequence encoding the adenosine base editor and (ii) a guide polynucleotide or a nucleic acid sequence encoding the guide polynucleotide, wherein the adenosine base editor comprises a programmable DNA binding domain and an adenosine deaminase domain, wherein the adenosine deaminase domain comprises an amino acid substitution at amino acid position 82 or 166 relative to a TadA reference sequence, or a corresponding position thereof, and wherein the guide polynucleotide directs the adenosine base editor to effect an A-to-G nucleobase alteration in the MECP2 gene or a regulatory element thereof, which comprises a SNP associated with Rett syndrome (RETT); wherein the A-to-G nucleobase alteration is at the SNP associated with RETT, which results in an R133C or an R306C amino acid mutation in a MECP2 polypeptide, or a variant thereof, encoded by the MECP2 gene.
2 . (canceled)
3 . The method of claim 1 , wherein the A-to-G nucleobase alteration changes the SNP associated with RETT to a wild type nucleobase.
4 - 7 . (canceled)
8 . The method of claim 1 , wherein the adenosine base editor is in complex with a single guide RNA (sgRNA) comprising a nucleic acid sequence complementary to the MECP2 gene or regulatory element thereof comprising the SNP associated with RETT.
9 . The method of claim 8 , wherein the guide polynucleotide comprises a nucleic acid sequence selected from 5′-AGAGCAAAAGGCUUUUCCCU-3′, 5′-UAGAGCAAAAGGCUUUUCCC-3′, 5′-UAGAGCAAAAGGCUUUUCCCU-3′, 5′-UUUAGAGCAAAAGGCUUUUCCCU-3′, 5′-UCUUGCACUUCUUGAUGGGG-3′, 5′-CUUGCACUUCUUGAUGGGGAG-3′, or 5′-GUCUUGCACUUCUUGAUGGGGAG-3′.
10 . A base editor system comprising (i) an adenosine base editor or a nucleic acid sequence encoding the adenosine base editor and (ii) a guide polynucleotide or a nucleic acid sequence encoding the guide polynucleotide, wherein the adenosine base editor comprises a programmable DNA binding domain and an adenosine deaminase domain, wherein the adenosine deaminase domain comprises an amino acid substitution at amino acid position 82 or 166 relative to a TadA reference sequence or a corresponding position thereof, and wherein the guide polynucleotide directs the adenosine base editor to effect an A-to-G nucleobase alteration in a methyl CpG binding protein 2 (MECP2) gene or regulatory element thereof, which comprises a SNP associated with Rett syndrome (RETT); wherein the A-to-G nucleobase alteration is at the SNP associated with RETT, which results in an R133C or an R306C amino acid mutation in a MECP2 polypeptide, or a variant thereof, encoded by the MECP2 gene.
11 - 16 . (canceled)
17 . A method of editing an MECP2 polynucleotide comprising a single nucleotide polymorphism (SNP) associated with Rett Syndrome (RETT), the method comprising contacting the MECP2 polynucleotide with an Adenosine Deaminase Base Editor 8 (ABE8) in a complex with one or more guide polynucleotides, wherein the ABE8 comprises a polynucleotide programmable DNA binding domain and an adenosine deaminase domain, and wherein one or more of said guide polynucleotides target said base editor to effect an A⋅T to G⋅C alteration of the SNP in the MECP2 polynucleotide associated with RETT, wherein the alteration is one or both of R133C or R306C.
18 - 31 . (canceled)
32 . The method of claim 17 , wherein the adenosine deaminase domain comprises an alteration at amino acid position 82 and/or 166 of
MSEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAIG
LHDPTAHAEIMALRQGGLVMQNYRLIDATLYVTFEPCVMCAGAMIHSRIG
RVVFGVRNAKTGAAGSLMDVLHYPGMNHRVEITEGILADECAALLCYFFR
MPRQVFNAQKKAQSSTD.
33 - 50 . (canceled)
51 . A cell produced by introducing into the cell, or a progenitor thereof:
an ABE8 base editor, or a polynucleotide encoding said base editor, wherein said ABE8 base editor comprises a polynucleotide programmable DNA binding domain and an adenosine deaminase domain; and
one or more guide polynucleotides that target the base editor to effect an A⋅T to GC alteration of the SNP in an MECP2 polynucleotide associated with RETT syndrome (RETT), wherein the alteration is one or both of R133C or R306C.
52 - 87 . (canceled)
88 . A method of treating RETT Syndrome (RETT) in a subject, comprising administering to said subject:
an ABE8 base editor, or a polynucleotide encoding said base editor, wherein said ABE8 base editor comprises a polynucleotide programmable DNA binding domain and an adenosine deaminase domain; and
one or more guide polynucleotides that target the ABE8 base editor to effect an A⋅T to G⋅C alteration of the SNP in an MECP2 polynucleotide associated with RETT, wherein the alteration is one or both of R133C and/or R306C.
89 - 120 . (canceled)
121 . A method of treating Rett syndrome (RETT) in a subject, the method comprising: administering to a subject in need thereof (i) an adenosine base editor or a nucleic acid sequence encoding the adenosine base editor and (ii) a guide polynucleotide or a nucleic acid sequence encoding the guide polynucleotide, wherein the adenosine base editor comprises a programmable DNA binding domain and an adenosine deaminase domain, wherein the adenosine deaminase domain comprises an amino acid substitution at amino acid position 82 or 166 relative to a TadA reference sequence, or a corresponding position thereof,
wherein the guide polynucleotide directs the adenosine base editor to effect an A-to-G nucleobase alteration in a methyl CpG binding protein 2 (MECP2) gene or a regulatory element thereof comprising a SNP associated with RETT in the subject, thereby treating RETT in the subject, and wherein the SNP associated with RETT results in an R133C or an R306C amino acid mutation in a MECP2 polypeptide, or a variant thereof, encoded by the MECP2 gene.
122 - 123 . (canceled)
124 . The method of 121 , wherein the A-to-G nucleobase alteration changes the SNP associated with RETT to a wild type or non-wild-type nucleobase.
125 - 133 . (canceled)
134 . The method of claim 133 , wherein the SNP associated with RETT results in an R133C amino acid mutation in a MECP2 polypeptide, or a variant thereof, encoded by the MECP2 gene.
135 . The method of claim 133 , wherein the SNP associated with RETT results in an R306C amino acid mutation in a MECP2 polypeptide, or a variant thereof, encoded by the MECP2 gene.
136 - 142 . (canceled)
143 . A guide polynucleotide or guide RNA comprising 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 contiguous nucleotides that are perfectly complementary to an MECP2 gene that encodes an MECP2 protein.
144 . A guide polynucleotide or guide RNA of claim 143 comprising a nucleic acid sequence selected from 5′-AGAGCAAAAGGCUUUUCCCU-3′, 5′-UAGAGCAAAAGGCUUUUCCC-3′, 5′-UAGAGCAAAAGGCUUUUCCCU-3′, 5′-UUUAGAGCAAAAGGCUUUUCCCU-3′, 5′-UCUUGCACUUCUUGAUGGGG-3′, 5′-CUUGCACUUCUUGAUGGGGAG-3′, or 5′-GUCUUGCACUUCUUGAUGGGGAG-3′.
145 . (canceled)
146 . A composition comprising an Adenosine Deaminase Base Editor 8 (ABE8) and a guide RNA, wherein the ABE8 comprises a polynucleotide programmable DNA binding domain and an adenosine deaminase domain, and wherein the guide RNA targets the base editor to effect an A⋅T to G⋅C alteration of the SNP in an MECP2 polynucleotide associated with RETT syndrome, and wherein the alteration is one or both of R133C or R306C.
147 - 179 . (canceled)
180 . A method of treating RETT syndrome, the method comprising administering to a subject in need thereof the pharmaceutical composition of claim 172 .
181 . Use of the pharmaceutical composition of claim 172 in the treatment of RETT syndrome in a subject.
182 . (canceled)
183 . A composition comprising the cell of claim 51 .
184 . (canceled)
185 . A pharmaceutical composition comprising (i) a nucleic acid encoding an ABE8 base editor; and (ii) the guide polynucleotide or guide RNA of claim 143 .
186 . The pharmaceutical composition of claim 185 , further comprising a lipid.
187 . The pharmaceutical composition of claim 186 , wherein the lipid is a cationic lipid.
188 . (canceled)