CNP Variants and Conjugates Thereof
The present disclosure, relates, in general, to stable variants of C-type natriuretic peptide (CNP) and uses thereof to treat bone-related disorders.
1 . A variant of C-type natriuretic peptide selected from the group consisting of
(SEQ ID NO: 5)
PGQEHPQARRYRGAQRRGLSRGCFGLKLDRIGSMSGLGC;
(SEQ ID NO: 1)
PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC;
(SEQ ID NO: 6)
PGQEHPNARRYRGANRRGLSRGCFGLKLDRIGSMSGLGC;
and
(SEQ ID NO: 7)
PGQEHPQARKYKGAQKKGLSKGCFGLKLDRIGSMSGLGC.
2 . The variant of claim 1 , wherein the peptide further comprises an acetyl group and/or wherein the peptide further comprises an OH or an NH 2 group at the C-terminus.
3 . The variant of claim 1 , wherein the acetyl group is on the N-terminus of the peptide.
4 . (canceled)
5 . The variant of claim 1 , comprising a conjugate moiety.
6 . The variant of claim 5 , wherein the conjugate moiety is on a residue of the CNP cyclic domain or at a site other than the CNP cyclic domain.
7 . (canceled)
8 . The variant of claim 5 , wherein the conjugate moiety comprises an acid moiety and/or wherein the conjugate moiety comprises an acid moiety linked to a hydrophilic spacer.
9 . (canceled)
10 . The variant of claim 8 , wherein the acid moiety and the hydrophilic spacer have the structure AEEA-AEEA-γGlu-C18DA.
11 . The variant of claim 1 wherein the peptide is selected from the group consisting of
(SEQ ID NO: 8)
Ac-PGQEHPQARRYRGAQRRGLSRGCFGLKLDRIGSMSGLGC-OH;
(SEQ ID NO: 9)
Ac-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-NH 2 ;
(SEQ ID NO: 10)
Ac-PGQEHPNARRYRGANRRGLSRGCFGLKLDRIGSMSGLGC-OH;
(SEQ ID NO: 11)
Ac-PGQEHPNARRYRGANRRGLSRGCFGLKLDRIGSMSGLGC-NH 2 ;
and
(SEQ ID NO: 12)
Ac-PGQEHPQARRYRGAQRRGLSRGCFGLKLDRIGSMSGLGC-NH 2 .
12 . The variant of claim 10 wherein the CNP variant is Ac-PGQEHPNARKYKGANKKGLSKGCFGLK(AEEA-AEEA-γGlu-C18DA)LDRIGSMSGLGC-OH (SEQ ID NO: 1) or PGQEHPNARKYKGANKKGLSKGCFGLK(AEEA-AEEA-γGlu-C18DA)LDRIGSMSGLGC-OH (SEQ ID NO: 1).
13 . The variant of claim 1 comprising a linker.
14 . (canceled)
15 . The variant of any one of claim 13 , wherein the linker is a hydrolysable linker and/or wherein the linker is on a lysine residue.
16 - 18 . (canceled)
19 . The variant of claim 13 wherein the linker is a peptoid linker or an electronic linker.
20 - 25 . (canceled)
26 . A pharmaceutical composition comprising a CNP variant according to claim 1 , and a pharmaceutically acceptable excipient, carrier or diluent.
27 - 29 . (canceled)
30 . A method of treating a bone-related disorder or skeletal dysplasia in a subject in need thereof comprising administering to the subject a composition comprising a CNP variant or composition of claim 1 .
31 . The method of claim 30 , wherein the bone-related disorder or skeletal dysplasia is selected from the group consisting of osteoarthritis, hypophosphatemic rickets, achondroplasia, hypochondroplasia, short stature, dwarfism, osteochondrodysplasias, thanatophoric dysplasia, osteogenesis imperfecta, achondrogenesis, chondrodysplasia punctata, homozygous achondroplasia, chondrodysplasia punctata, camptomelic dysplasia, congenital lethal hypophosphatasia, perinatal lethal type of osteogenesis imperfecta, short-rib polydactyly syndromes, hypochondroplasia, rhizomelic type of chondrodysplasia punctata, Jansen-type metaphyseal dysplasia, spondyloepiphyseal dysplasia congenita, atelosteogenesis, diastrophic dysplasia, congenital short femur, Langer-type mesomelic dysplasia, Nievergelt-type mesomelic dysplasia, Robinow syndrome, Reinhardt syndrome, acrodysostosis, peripheral dysostosis, Kniest dysplasia, fibrochondrogenesis, Roberts syndrome, acromesomelic dysplasia, micromelia, Morquio syndrome, Kniest syndrome, metatrophic dysplasia, and spondyloepimetaphyseal dysplasia, NPR2 mutation, SHOX mutation (Turner's syndrome/Leri Weill), PTPN11 mutations (Noonan's syndrome), insulin growth factor 1 receptor (IGF1R) mutation, and idiopathic short stature.
32 . A method of elongating a bone or increasing long bone growth in a subject in need thereof, comprising administering to the subject a composition comprising a CNP variant or composition of claim 1 , and wherein the administering elongates a bone or increases long bone growth.
33 . The method of claim 32 , wherein the composition is administered subcutaneously, intradermally, intraarticularly, orally, or intramuscularly.
34 . (canceled)
35 . The method of claim 30 wherein the composition is an extended release composition.
36 . A method of treating a CNP-responsive condition or disorder, comprising
administering a CNP variant or composition of claim 1 to a subject, and
monitoring the level of at least one bone- or cartilage-associated biomarker in the subject,
wherein an increase in the level of the at least one bone- or cartilage-associated biomarker indicates a therapeutic effect of the CNP variant on the subject or the condition or disorder.
37 . (canceled)
38 . The method of claim 36 , wherein the at least one bone- or cartilage-associated biomarker is selected from the group consisting of CNP, cGMP, propeptides of collagen type II and fragments thereof, collagen type II and fragments thereof, collagen type I C-telopeptide (CTx), osteocalcin, proliferating cell nuclear antigen (PCNA), propeptides of type I procollagen (PINP) and fragments thereof, collagen type I and fragments thereof, aggrecan chondroitin sulfate, collagen X, and alkaline phosphatase.
39 . A method of making a CNP variant of claim 1 comprising synthesizing the peptide on a solid-phase resin using Fmoc amino acids.
40 - 42 . (canceled)