IP Library Granted Patent US 12,410,262
Granted Patent B2
US 12,410,262 · App. 18/174,981 · Granted Sep 9, 2025

Peptide conjugates of cytotoxins as therapeutics

Inventors: Daniel Richard Marshall (New Haven, CT); Johanna Marie Csengery (New Fairfield, CT); Robert John Maguire (New Haven, CT); Robert A. Volkmann (Mystic, CT)
Assignee: Cybrexa 2, Inc.
C07K19/00A61K31/4745A61P35/00C07D491/147C07D491/16C07D491/22C07K14/00A61K38/00C07K2319/00
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,410,262
App. No.
18/174,981
Granted
Sep 9, 2025
Kind
B2
Abstract

The present invention relates to peptide conjugates of cytotoxins such as topoisomerase I inhibitors which are useful for the treatment of diseases such as cancer.

Claims (49)

1. A method of treating cancer in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound of Formula (I):

R 8 -Q-R 7   (I)

or a pharmaceutically acceptable salt thereof, wherein:

R 7 is a peptide;

R 8 is:

Q is:

R 1 and R 3 together with the carbon atoms to which they are attached form a C 3-14 cycloalkyl group or 4-14 membered heterocycloalkyl group, each optionally substituted with 1, 2, or 3 substituents independently selected from C 1-4 alkyl, halo, CN, NO 2 , OR a1 , SR a1 , C(O)R b1 , C(O)NR c1 R d1 , C(O)OR a1 , OC(O)R b1 , OC(O)NR c1 R d1 , NR c1 R d1 , NR c1 C(O)R b1 , NR c1 C(O)OR a1 , and NR c1 C(O)NR c1 R d1 ;

R 2 and R 4 are each independently selected from H, C 1-4 alkyl, C 1-4 alkenyl, C 6-10 aryl, C 3-10 cycloalkyl, 5-10 membered heteroaryl, 4-10 membered heterocycloalkyl, halo, CN, NO 2 , OR a1 , SR a1 , C(O)R b1 , C(O)NR c1 R d1 , C(O)OR a1 , OC(O)R b1 , OC(O)NR c1 R d1 , NR c1 R d1 , NR c1 C(O)R b1 , NR c1 C(O)OR a1 , and NR c1 C(O)NR c1 R d1 , wherein said C 1-4 alkyl, C 1-4 alkenyl, C 6-10 aryl, C 3-10 cycloalkyl, 5-10 membered heteroaryl, and 4-10 membered heterocycloalkyl, are each optionally substituted with 1, 2, or 3 substituents independently selected from halo, CN, NO 2 , OR a1 , SR a1 , C(O)R b1 , C(O)NR c1 R d1 , C(O)OR a1 , OC(O)R b1 , OC(O)NR c1 R d1 , NR c1 R d1 , NR c1 C(O)R b1 , NR c1 C(O)OR a1 , and NR c1 C(O)NR c1 R d1 , and

R a1 , R b1 , R c1 , and R d1 are each independently selected from H, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-6 haloalkyl, OH, CN, NO 2 , and CO 2 CH 3 ; wherein said C 1-6 alkyl and C 2-6 alkenyl are each optionally substituted with OH, CN, NO 2 , or CO 2 CH 3 .

2. The method of claim 1 , wherein the cancer is selected from bladder cancer, bone cancer, glioma, breast cancer, cervical cancer, colon cancer, colorectal cancer, endometrial cancer, epithelial cancer, esophageal cancer, Ewing's sarcoma, pancreatic cancer, gallbladder cancer, gastric cancer, gastrointestinal tumors, head and neck cancer, intestinal cancers, Kaposi's sarcoma, kidney cancer, laryngeal cancer, liver cancer, lung cancer, melanoma, prostate cancer, rectal cancer, renal clear cell carcinoma, skin cancer, stomach cancer, testicular cancer, thyroid cancer, and uterine cancer.

3. The method of claim 1 , wherein the cancer is selected from breast cancer, colorectal cancer, and gastric cancer.

4. The method of claim 2 , wherein the breast cancer is triple-negative breast cancer.

5. The method of claim 1 , wherein the cancer is ovarian cancer.

6. The method of claim 1 , wherein R 7 is a peptide capable of selectively delivering R 8 Q-across a cell membrane having an acidic or hypoxic mantle having a pH less than about 6.0.

7. The method of claim 1 , wherein R 7 is a peptide comprising at least one of the following sequences:

ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1; Pv1);

AEQNPIYWARYADWLFTTPLLLLDLALLVDADECG (SEQ ID NO: 2; Pv2);

ADDQNPWRAYLDLLFPTDTLLLDLLWDADECG (SEQ ID NO: 3; Pv3);

Ac-AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTKCG (SEQ ID NO: 4; Pv4); and

AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTC (SEQ ID No. 5; Pv5);

and wherein R 7 is attached to Q through a cysteine residue of R 7 .

8. The method of claim 1 , wherein R 7 is a peptide comprising at least one of the following sequences:

ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1; Pv1),

AEQNPIYWARYADWLFTTPLLLLDLALLVDADECG (SEQ ID NO: 2; Pv2), and

ADDQNPWRAYLDLLFPTDTLLLDLLWDADECG (SEQ ID NO: 3; Pv3),

and wherein R 7 is attached to Q through a cysteine residue of R 7 .

9. The method of claim 1 , wherein R 7 is a peptide comprising the sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1; Pv1).

10. The method of claim 1 , wherein R 7 is a peptide comprising the sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADECG (SEQ ID NO: 2; Pv2).

11. The method of claim 1 , wherein R 1 and R 3 together with the carbon atom to which they are attached form a cyclopentyl, cyclohexyl, cycloheptyl, 1,2,3,4-tetrahydronaphthyl, tetrahydrofuranyl, or tetrahydropyranyl.

12. The method of claim 1 , wherein R 1 and R 3 together with the carbon atom to which they are attached form a C 3-7 cycloalkyl group.

13. The method of claim 1 , wherein R 1 and R 3 together with the carbon atom to which they are attached form a cyclohexyl group.

14. The method of claim 1 , wherein Q is:

15. The method of claim 1 , wherein R 2 and R 4 are each H.

16. The method of claim 1 , wherein the compound is selected from:

wherein Pv2 is a peptide comprising the sequence:

(SEQ ID NO: 2)

AEQNPIYWARYADWLFTTPLLLLDLALLVDADECG.

17. The method of claim 1 , wherein the compound is selected from:

wherein Pv1 is a peptide comprising the sequence:

(SEQ ID NO: 1)

ADDQNPWRAYLDLLFPTDTLLLDLLWCG.

18. The method of claim 1 , wherein the compound is:

wherein Pv1 is a peptide comprising the sequence:

(SEQ ID NO: 1)

ADDQNPWRAYLDLLFPTDTLLLDLLWCG.

19. The method of claim 1 , wherein the compound is:

wherein Pv1 is a peptide comprising the sequence:

(SEQ ID NO: 1)

ADDQNPWRAYLDLLFPTDTLLLDLLWCG.

Assignments (3)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Apr 27, 2023
From: VOLKMANN, ROBERT A.
To: BIOPHARMAWORKS LLC
Reel/Frame 063457/0942 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Apr 27, 2023
From: BIOPHARMAWORKS LLC
To: CYBREXA 2, INC.
Reel/Frame 063458/0022 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Apr 27, 2023
From: MARSHALL, DANIEL RICHARD; CSENGERY, JOHANNA MARIE; MAGUIRE, ROBERT JOHN
To: CYBREXA 2, INC.
Reel/Frame 063458/0128 →
Continuity (4)
Continuation 16925094 · Jul 9, 2020
Provisional Application 63040859 · Jun 18, 2020
Provisional Application 62872643 · Jul 10, 2019
Related Publication 20240010755A1 · Jan 11, 2024
References Cited (337)
US 5658920A · Terasawa et al. · 1997 [cited by applicant]
US 5770605A · Terasawa et al. · 1998 [cited by applicant]
US 5834476A · Terasawa et al. · 1998 [cited by applicant]
US 6100283A · Griffin et al. · 2000 [cited by applicant]
US 6172230B1 · Kamihara et al. · 2001 [cited by applicant]
US 6291671B1 · Inoue et al. · 2001 [cited by applicant]
US 6310082B1 · Griffin et al. · 2001 [cited by applicant]
US 6337400B1 · Kamihara et al. · 2002 [cited by applicant]
US 6436912B1 · Inoue et al. · 2002 [cited by applicant]
US 6495541B1 · Webber et al. · 2002 [cited by applicant]
US 6504029B1 · Kamihara et al. · 2003 [cited by applicant]
US 6548494B1 · Webber et al. · 2003 [cited by applicant]
US 6552197B2 · Kamihara et al. · 2003 [cited by applicant]
US 6696437B1 · Lubisch et al. · 2004 [cited by applicant]
US 6811996B1 · Inoue et al. · 2004 [cited by applicant]
US 6815435B2 · Takahashi et al. · 2004 [cited by applicant]
US 6835807B1 · Susaki et al. · 2004 [cited by applicant]
US 6838450B2 · Inoue et al. · 2005 [cited by applicant]
US 6844318B2 · Copeland et al. · 2005 [cited by applicant]
US 7041818B2 · Susaki et al. · 2006 [cited by applicant]
US 7151102B2 · Martin et al. · 2006 [cited by applicant]
US 7196085B2 · Martin et al. · 2007 [cited by applicant]
US 7276497B2 · Chari et al. · 2007 [cited by applicant]
US 7301019B2 · Widdison et al. · 2007 [cited by applicant]
US 7374762B2 · Amphlett et al. · 2008 [cited by applicant]
US 7411063B2 · Widdison et al. · 2008 [cited by applicant]
US 7449464B2 · Martin et al. · 2008 [cited by applicant]
US 7473796B2 · Chari et al. · 2009 [cited by applicant]
US 7494649B2 · Amphlett et al. · 2009 [cited by applicant]
US 7501120B2 · Amphlett et al. · 2009 [cited by applicant]
US 7514080B2 · Amphlett et al. · 2009 [cited by applicant]
US 7531530B2 · Helleday et al. · 2009 [cited by applicant]
US 7692006B2 · Menear · 2010 [cited by applicant]
US 7771727B2 · Fuselier et al. · 2010 [cited by applicant]
US 7781596B1 · Lubisch et al. · 2010 [cited by applicant]
US 7811572B2 · Dai et al. · 2010 [cited by applicant]
US 7851432B2 · Chari et al. · 2010 [cited by applicant]
US 7989598B2 · Steeves et al. · 2011 [cited by applicant]
US 8012485B2 · Amphlett et al. · 2011 [cited by applicant]
US 8067613B2 · Gandhi · 2011 [cited by applicant]
US 8071623B2 · Jones et al. · 2011 [cited by applicant]
US 8076451B2 · Reshetnyak et al. · 2011 [cited by applicant]
US 8088387B2 · Steeves et al. · 2012 [cited by applicant]
US 8137669B2 · Goldmakher et al. · 2012 [cited by applicant]
US 8163888B2 · Steeves et al. · 2012 [cited by applicant]
US 8198417B2 · Steeves et al. · 2012 [cited by applicant]
US 8383122B2 · Dai et al. · 2013 [cited by applicant]
US 8388960B2 · Goldmakher et al. · 2013 [cited by applicant]
US 8435528B2 · Chari et al. · 2013 [cited by applicant]
US 8563509B2 · Chari et al. · 2013 [cited by applicant]
US 8603483B2 · Chen et al. · 2013 [cited by applicant]
US 8624003B2 · Kellogg et al. · 2014 [cited by applicant]
US 8685920B2 · Chari et al. · 2014 [cited by applicant]
US 8697736B2 · Penning et al. · 2014 [cited by applicant]
US 8703909B2 · Reshetnyak et al. · 2014 [cited by applicant]
US 8754190B2 · Ashley et al. · 2014 [cited by applicant]
US 8795673B2 · Li et al. · 2014 [cited by applicant]
US 8841425B2 · Chari et al. · 2014 [cited by applicant]
US 8859756B2 · Ross et al. · 2014 [cited by applicant]
US 8933205B2 · Dai et al. · 2015 [cited by applicant]
US 9090629B2 · Chari et al. · 2015 [cited by applicant]
US 9150649B2 · Singh et al. · 2015 [cited by applicant]
US 9289508B2 · Reshetnyak et al. · 2016 [cited by applicant]
US 9376500B2 · Kellogg et al. · 2016 [cited by applicant]
US 9428543B2 · Li et al. · 2016 [cited by applicant]
US 9676823B2 · Reshetnyak et al. · 2017 [cited by applicant]
US 9771432B2 · Kellogg et al. · 2017 [cited by applicant]
US 9789204B2 · Dai et al. · 2017 [cited by applicant]
US 9808537B2 · Masuda et al. · 2017 [cited by applicant]
US 9814781B2 · Reshetnyak et al. · 2017 [cited by applicant]
US 9872924B2 · Naito et al. · 2018 [cited by applicant]
US 9914748B2 · Li et al. · 2018 [cited by applicant]
US 9919059B2 · Wong et al. · 2018 [cited by applicant]
US 9999680B2 · Widdison · 2018 [cited by applicant]
US 10064855B2 · Langecker et al. · 2018 [cited by applicant]
US 10195288B2 · Masuda et al. · 2019 [cited by applicant]
US 10383878B2 · Hettmann et al. · 2019 [cited by applicant]
US 10413615B2 · Hutchins · 2019 [cited by applicant]
US 10435432B2 · Li et al. · 2019 [cited by applicant]
US 10695396B2 · Fukuda et al. · 2020 [cited by applicant]
US 10729782B2 · Naito et al. · 2020 [cited by applicant]
US 10844135B2 · Chari et al. · 2020 [cited by applicant]
US 10933069B2 · Marchall et al. · 2021 [cited by applicant]
US 11555019B2 · Marshall et al. · 2023 [cited by applicant]
US 11634508B2 · Marshall et al. · 2023 [cited by applicant]
US 20030105109A1 · Lavielle et al. · 2003 [cited by applicant]
US 20040235840A1 · Chari et al. · 2004 [cited by applicant]
US 20050256030A1 · Feng · 2005 [cited by applicant]
US 20080233107A1 · Reshetnyak et al. · 2008 [cited by applicant]
US 20120039990A1 · Reshetnyak et al. · 2012 [cited by applicant]
US 20120045524A1 · Wernet et al. · 2012 [cited by applicant]
US 20120266262A1 · Ashkenazi et al. · 2012 [cited by applicant]
US 20150051153A1 · Reshetnyak et al. · 2015 [cited by applicant]
US 20160303254A1 · Kolakowski et al. · 2016 [cited by applicant]
US 20170035906A1 · Naito et al. · 2017 [cited by applicant]
US 20170112891A1 · Dragovich et al. · 2017 [cited by applicant]
US 20170145044A1 · Hudson et al. · 2017 [cited by applicant]
US 20170207277A1 · Park · 2017 [cited by applicant]
US 20170226220A1 · Chari et al. · 2017 [cited by applicant]
US 20170267727A1 · Thevenin et al. · 2017 [cited by applicant]
US 20170267765A1 · Tsao · 2017 [cited by applicant]
US 20170274093A1 · Goldenberg et al. · 2017 [cited by applicant]
US 20180043013A1 · Chari et al. · 2018 [cited by applicant]
US 20180071403A1 · Naito et al. · 2018 [cited by applicant]
US 20180221500A1 · Reshetnyak et al. · 2018 [cited by applicant]
US 20190008981A1 · Masuda et al. · 2019 [cited by applicant]
US 20190010229A1 · Amphlett et al. · 2019 [cited by applicant]
US 20190030177A1 · Dai et al. · 2019 [cited by applicant]
US 20190151328A1 · Hettmann et al. · 2019 [cited by applicant]
US 20190175684A1 · Fukuda et al. · 2019 [cited by applicant]
US 20190209580A1 · Marshall et al. · 2019 [cited by applicant]
US 20200237926A1 · Reshetnyak et al. · 2020 [cited by applicant]
US 20200306243A1 · Howard et al. · 2020 [cited by applicant]
US 20210009536A1 · Marshall et al. · 2021 [cited by applicant]
US 20210009719A1 · Marshall et al. · 2021 [cited by applicant]
US 20210299137A1 · Marshall et al. · 2021 [cited by applicant]
US 20230416331A1 · Maguire et al. · 2023 [cited by applicant]
US 20240067616A1 · Marshall et al. · 2024 [cited by applicant]
US 20240093250A1 · Maguire et al. · 2024 [cited by applicant]
US 20240226308A1 · Paralkar et al. · 2024 [cited by applicant]
AU 2007247969 · 2007 [cited by applicant]
CN 1195985 · 1998 [cited by applicant]
CN 1342161 · 2002 [cited by applicant]
CN 1418112 · 2003 [cited by applicant]
CN 101370497 · 2009 [cited by applicant]
CN 102014956 · 2011 [cited by applicant]
CN 101098854 · 2012 [cited by applicant]
CN 106163559 · 2016 [cited by applicant]
CN 109232719 · 2019 [cited by applicant]
CN 110312549 · 2019 [cited by applicant]
EP 1838715 · 2010 [cited by applicant]
EP 2399609 · 2011 [cited by applicant]
EP 1945647 · 2012 [cited by applicant]
EP 1928503 · 2012 [cited by applicant]
EP 1853322 · 2014 [cited by applicant]
EP 3130608 · 2017 [cited by applicant]
EP 2691155 · 2018 [cited by applicant]
EP 2437790 · 2019 [cited by applicant]
JP H11510154 · 1999 [cited by applicant]
JP 2002534523 · 2002 [cited by applicant]
JP 2004520450 · 2004 [cited by applicant]
JP 2018535212 · 2018 [cited by applicant]
KR 20160105146 · 2016 [cited by applicant]
NC 20160001001 · 2016 [cited by applicant]
TW I249527 · 2006 [cited by applicant]
TW I460175 · 2014 [cited by applicant]
WO WO9902530 · 1999 [cited by applicant]
WO WO2000042040 · 2000 [cited by applicant]
WO WO2001041534 · 2001 [cited by applicant]
WO WO2002098883 · 2002 [cited by applicant]
WO WO2003080047 · 2003 [cited by applicant]
WO WO2004087713 · 2004 [cited by applicant]
WO WO2004103272 · 2004 [cited by applicant]
WO WO2004110498 · 2004 [cited by applicant]
WO WO2005012305 · 2005 [cited by applicant]
WO WO2005012524 · 2005 [cited by applicant]
WO WO2005037992 · 2005 [cited by applicant]
WO WO2005053662 · 2005 [cited by applicant]
WO WO2005112919A2 · 2005 [cited by examiner]
WO WO2006012527 · 2006 [cited by applicant]
WO WO2006033003 · 2006 [cited by applicant]
WO WO2006033006 · 2006 [cited by applicant]
WO WO2006033007 · 2006 [cited by applicant]
WO WO2006062779 · 2006 [cited by applicant]
WO WO2006078809 · 2006 [cited by applicant]
WO WO2006078816 · 2006 [cited by applicant]
WO WO2006113623 · 2006 [cited by applicant]
WO WO2007024536 · 2007 [cited by applicant]
WO WO2007056550 · 2007 [cited by applicant]
WO WO2008114114 · 2008 [cited by applicant]
WO WO2009002993 · 2008 [cited by applicant]
WO WO2009026177 · 2009 [cited by applicant]
WO WO2009134952 · 2009 [cited by applicant]
WO WO2009134976 · 2009 [cited by applicant]
WO WO2010141566 · 2010 [cited by applicant]
WO WO2011066418 · 2011 [cited by applicant]
WO WO2011098971 · 2011 [cited by applicant]
WO WO2011106639 · 2011 [cited by applicant]
WO WO2012047354 · 2012 [cited by applicant]
WO WO2012061590 · 2012 [cited by applicant]
WO WO2012135517 · 2012 [cited by applicant]
WO WO2013055987 · 2013 [cited by applicant]
WO WO2014057687 · 2014 [cited by applicant]
WO WO2014061277 · 2014 [cited by applicant]
WO WO2014066002 · 2014 [cited by applicant]
WO WO2014107024 · 2014 [cited by applicant]
WO WO2014134483 · 2014 [cited by applicant]
WO WO2015095755 · 2015 [cited by applicant]
WO WO2015108986 · 2015 [cited by applicant]
WO WO2015117002 · 2015 [cited by applicant]
WO WO2015146132 · 2015 [cited by applicant]
WO WO2015155976 · 2015 [cited by applicant]
WO WO2015155998 · 2015 [cited by applicant]
WO WO2016004043 · 2016 [cited by applicant]
WO WO2016028689 · 2016 [cited by applicant]
WO WO2016057398 · 2016 [cited by applicant]
WO WO2016081584 · 2016 [cited by applicant]
WO WO2016083433 · 2016 [cited by applicant]
WO WO2017064675 · 2017 [cited by applicant]
WO WO2017180834 · 2017 [cited by applicant]
WO WO2017199042 · 2017 [cited by applicant]
WO WO2017210608 · 2017 [cited by applicant]
WO WO2018023098 · 2018 [cited by applicant]
WO WO2018057912 · 2018 [cited by applicant]
WO WO2018095422 · 2018 [cited by applicant]
WO WO2018227132 · 2018 [cited by applicant]
WO WO2019044946 · 2019 [cited by applicant]
WO WO2019136298 · 2019 [cited by applicant]
WO WO2019140271 · 2019 [cited by applicant]
WO WO2019219891 · 2019 [cited by applicant]
WO WO2019236954 · 2019 [cited by applicant]
WO WO2020160009 · 2020 [cited by applicant]
WO WO2021007402 · 2021 [cited by applicant]
WO WO2021007435 · 2021 [cited by applicant]
WO WO2022150596 · 2022 [cited by applicant]
Liu et al., “Perspectives on Biologically Active Camptothecin Derivatives,” Medicinal Research Reviews, Mar. 2015, 35(4):753-789, 38 pages. [cited by applicant]
Office Action in Chinese Appln. No. 202080057842.4, dated Jul. 10, 2024, 32 pages (with machine translation). [cited by applicant]
Akaiwa et al., “Antibody-Drug Conjugate Payloads: Study of Auristatin Derivatives.” Chem. Pharm. Bull., Mar. 2020, 68(3):201-211. [cited by applicant]
Gores et al., “Swelling, reductive stress, and cell death during chemical hypoxia in hepatocytes, ” Am. J. Physiol., Aug. 1989, 257(2):C347-C354. [cited by applicant]
Harms et al., “The pKa Values of Acidic and Basic Residues Buried at the Same Internal Location in a Protein Are Governed by Different Factors,” J. Mol. Biol., May 2009, 389(1):34-47, 30 pages. [cited by applicant]
Helft et al., “A Phase I Study of Cantuzumab Mertansine Administered as a Single Intravenous Infusion Once Weekly in Patients with Advanced Solid Tumors,” Clin. Cancer Res., Jul. 2004, 10(13):4363-4368. [cited by applicant]
International Preliminary Report on Patentability in International Appln. No. PCT/US2022/071967, mailed on Nov. 9, 2023, 10 pages. [cited by applicant]
International Preliminary Report on Patentability in International Appln. No. PCT/US2022/079973, mailed May 30, 2024, 8 pages. [cited by applicant]
International Search Report and Written Opinion in International Appln. No. PCT/US2022/071967, mailed on Jul. 21, 2022, 19 pages. [cited by applicant]
KADCYLA (ado-trastuzumab emtansine) Prescribing Information, Revised May 2019, 31 pages. [cited by applicant]
Legarza et al., “Novel Camptothecin Derivatives,” in vivo, Jan. 1, 2005, 19(1):283-92. [cited by applicant]
Office Action in Chinese Appln. No. 202080057629.3, dated May 30, 2024, 16 pages (with English translation). [cited by applicant]
Search Report in Malaysia Appln. No. PI2020003488, dated Nov. 23, 2023, 7 pages (with English translation). [cited by applicant]
Search Report in Taiwan Appln. No. 109123269, dated Mar. 6, 2024, 9 pages (with English translation). [cited by applicant]
Search Report in Taiwan Appln. No. 109123266, dated Mar. 5, 2024, 8 pages (with English translation). [cited by applicant]
Seeli et al., “Guar gum oleate-graft-poly(methacrylic acid) hydrogel as a colon-specific controlled drug delivery carrier,” Carbohydrate Polymers, Feb. 2017, 158:51-57. [cited by applicant]
Sehn et al., “Polatuzumab Vedotin in Relapsed or Refractory Diffuse Large B-Cell Lymphoma,” J. Clin. Oncol., Jan. 2020, 38(2):155-165, 22 pages. [cited by applicant]
Singhal et al., “Oxygen battle in the gut: Hypoxia and hypoxia-inducible factors in metabolic and inflammatory responses in the intestine,” J. Biol. Chem., Jul. 2020, 295(30):10493-10505. [cited by applicant]
Venditto et al., “Cancer Therapies Utilizing the Camptothecins: A review of the in vivo literature, ” Molecular pharmaceutics, Apr. 5, 2010, 7(2):307-49. [cited by applicant]
Zeng et al., “Hypoxia-activated prodrugs and redox-responsive nanocarriers,” Int. J. Nanomed., Oct. 2018, 13:6551-6574. [cited by applicant]
Adams et al., “The cleavage of meso-epoxides with homochiral thiols: synthesis of (+)- and (−)-trans-1-mercaptocyclohexan-2-ol,” Tetrahedron: Asymmetry, Oct. 1999, 10(21):4129-4142. [cited by applicant]
Maheswara et al., “A new strategy for chemoselective O-acylation of ß-mercapto alcohols via alkylsilyl and stannyl protection,” Tetrahedron Letters, Jan. 2009, 50(4):480-483. [cited by applicant]
Office Action and Search Report in Eurasian Appln. No. 202391970, dated Aug. 28, 2024, 18 pages (with English translation). [cited by applicant]
[No. Author Listed], “Research progress of PARP inhibitors combined with chemotherapy drugs in the treatment of malignant tumors,” Tumor, Dec. 2013, 372-377, 1 page (English abstract). [cited by applicant]
Adiyala et al., “Development of pyrrolo [2,1-c][1,4] benzodiazepine ß-glucoside prodrugs for selective therapy of cancer,” Bioorganic Chemistry, Feb. 2018, 76:288-293. [cited by applicant]
Aiello et al., “Abstract #6249: CBX-12: A low pH targeting alphalex™-exatecan conjugate for the treatment of solid tumors,” Abstract, Cancer Research, Aug. 2020, 80(16): 4 pages, URL <https://cancerres.aacrjournals.org/… [cited by applicant]
Aiello et al., “Abstract #6249: CBX-12: A low pH targeting alphalex™-exatecan conjugate for the treatment of solid tumors,” Poster, presented at the AACR Annual Meeting 2020, Philadelphia, PA, Apr. 27-28, 2020 and Jun. … [cited by applicant]
Aiello et al., “Abstract #63: Development of tumor-targeted PARP inhibitors for the treatment of solid cancers,” Poster, presented at the Dublin, Ireland meeting “Molecular Targets and Cancer Therapeutics,” Dublin, Irel… [cited by applicant]
Anderson et al., “Protease-Sensitive Nanomaterials for Cancer Therapeutics and Imaging,” Ind. Eng. Chem Res., Apr. 2017, 56(20):5761-5777. [cited by applicant]
Atzrodt et al., “The Renaissance of H/D Exchange,” Angewandte Chemie International Edition, Oct. 2007, 46(41):7744-7765. [cited by applicant]
Bargh et al., “Cleavable linkers in antibody-drug conjugates,” Chem. Soc. Rev., Aug. 2019, 48(16):4361-4374, 15 pages. [cited by applicant]
Berge et al., “Pharmaceutical Salts,” Journal of Pharmaceutical Sciences, Jan. 1977, 66(1):1-19. [cited by applicant]
Burns et al., “Inhibition of Cancer Cell Proliferation and Breast Tumor Targeting of pHLIP-Monomethyl Auristatin E Conjugates, ” Mol. Pharmaceutics, Mar. 2015, 9 pages. [cited by applicant]
Burns et al., “Therapeutic Efficacy of a Family of pHLIP-MMAF Conjugates in Cancer Cells & Mouse Models,” Mol. Pharmaceutics, Jan. 2017, 31 pages. [cited by applicant]
Caculitan et al., “Cathepsin B Is Dispensable for Cellular Processing of Cathepsin B-Cleavable Antibody-Drug Conjugates,” Cancer Res., Dec. 2017, 77(24):7027-7037. [cited by applicant]
Catcott et al., “Microscale screening of antibody libraries as maytansinoid antibody-drug conjugates,” mAbs, Jan. 2016, 8(3):513-523. [cited by applicant]
Catsburg et al., “Adherence to cancer prevention guidelines and risk of breast cancer,” International Journal of Cancer, 2014, 135:2444-2452. [cited by applicant]
Chang et al., “Stapled α- helical peptide drug development: A potent dual inhibitor of MDM2 and MDMX for p53-dependent cancer therapy,” Proceedings of the National Academy of Sciences, Sep. 2013, 110(36):E3445-E3454. [cited by applicant]
Cheng et al., “MicroRNA silencing for cancer therapy targeted to the tumor microenvironment,” Nature, Feb. 2015, 518:107-110. [cited by applicant]
Choi et al., “Protease-Activated Drug Development,” Theranostics, Feb. 2012, 2(2):156-178. [cited by applicant]
CO Office Action in Colombia Appln. No. NC2020/0009665, dated Sep. 26, 2022, 21 pages (with English translation). [cited by applicant]
Corso et al., “Innovative Linker Strategies for Tumor-Targeted Drug Conjugates,” Chem. Eur. J., Nov. 2019, 25(65):14740-14757, 17 pages. [cited by applicant]
Dahan et al., “Dipeptidyl Peptidase IV as a Potential Target for Selective Prodrug Activation and Chemotherapeutic Action in Cancers,” Mol. Pharmaceutics, Nov. 2014, 11(12):4385-4394. [cited by applicant]
De Marco, “Recombinant polypeptide production in [cited by applicant]
Diez-Torrubia et al., “Application of the Dipeptidyl Peptidase IV (DPPIV/CD26) Based Prodrug Approach to Different Amine-Containing Drugs,” J. Med. Chem. 2010, 53(2):559-572. [cited by applicant]
Diez-Torrubia et al., “Dipeptidyl Peptidase IV (DPPIV/CD26)-Based Prodrugs of Hydroxy-Containing Drugs,” ChemMedChem, Apr. 2012, 7(4):618-628. [cited by applicant]
Dougherty et al., “Enhancing the Cell Permeability of Stapled Peptides with a Cyclic Cell-Penetrating Peptide,” Journal of Medicinal Chemistry, Oct. 2019, 62(22):10098-10107. [cited by applicant]
Dougherty et al., “Understanding Cell Penetration of Cyclic Peptides,” Chemical Reviews, May 2019, 119(17):47 pages. [cited by applicant]
Ducret, “Lipase-catalyzed enantioselective esterification of ibuprofen in organic solvents under controlled water activity,” Enzyme and Microbial Technology, Mar. 1998, 22(4):212-216. [cited by applicant]
Fan et al, “Going Beyond Common Drug Metabolizing Enzymes: Case Studies of Biotransformation Involving Aldehyde Oxidase, g-Glutamyl Transpeptidase, Cathepsin B, Flavin-Containing Monooxygenase, and ADP-Ribosyltransferas… [cited by applicant]
Fang, “Development of Synthetic Lethality Anticancer Therapeutics,” J. Med. Chem., Jun. 2014, 57:7859-7873. [cited by applicant]
Garcia-Aparicio et al., “Design and Discovery of a Novel Dipeptidyl-peptidase IV (CD26)-Based Prodrug Approach,” J. Med. Chem., Aug. 2006, 49(17):5339-5351. [cited by applicant]
Gayle et al., “Abstract #6242: Development of alphalex™-toxin low pH targeting conjugates for the treatment of solid tumors,” Abstract, Cancer Research, Aug. 2020, 80(16): 3 pages, URL <https://cancerres.aacrjournals.or… [cited by applicant]
Gayle et al., “Abstract #6242: Development of alphalex™-toxin low pH targeting conjugates for the treatment of solid tumors,” Poster, presented at the AACR Annual Meeting 2020, Philadelphia, PA, Apr. 27-28, 2020 and Jun… [cited by applicant]
Grinda et al., “A self-immolative dendritic glucuronide prodrug of doxorubicin,” Med. Chem. Commun., 2012, 3:68-70. [cited by applicant]
Guerlavais et al., “Advancements in Stapled Peptide Drug Discovery & Development,” Annual Reports in Medicinal Chemistry, Jan. 2014, 49:331-345. [cited by applicant]
Harris, “Hypoxia—a key regulatory factor in tumour growth,” Nat Rev Cancer, Jan. 2002, 2(1):38-47. [cited by applicant]
Hegan et al., “Inhibition of poly(ADP-ribose) polymerase downregulates BRCA1 and RAD51 in a pathway mediated by E2F4 and p130,” PNAS, Feb. 2010, 107(5):2201-2206. [cited by applicant]
Herceg et al., “Design, synthesis and in vitro evaluation of ß-glucuronidase-sensitive prodrug of 5-aminolevulinic acid for photodiagnosis of breast cancer cells,” Bioorganic Chemistry, Aug. 2018, 78:372-380. [cited by applicant]
International Preliminary Report on Patentability in International Appln. No. PCT/US2019/012413, mailed Jul. 16, 2020, 8 pages. [cited by applicant]
International Preliminary Report on Patentability in International Appln. No. PCT/US2020/041348, mailed Jan. 20, 2022, 8 pages. [cited by applicant]
International Preliminary Report on Patentability in International Appln. No. PCT/US2020/041411, mailed Jan. 20, 2022, 8 pages. [cited by applicant]
International Search Report and Written Opinion in International Appln. No. PCT/US2019/012413, dated Mar. 26, 2019, 19 pages. [cited by applicant]
International Search Report and Written Opinion in International Appln. No. PCT/US2020/041348, dated Oct. 15, 2020, 16 pages. [cited by applicant]
International Search Report and Written Opinion in International Appln. No. PCT/US2020/041411, mailed Nov. 10, 2020, 17 pages. [cited by applicant]
International Search Report and Written Opinion in International Appln. No. PCT/US2022/011629, mailed May 9, 2022, 22 pages. [cited by applicant]
International Search Report and Written Opinion in International Appln. No. PCT/US2022/079973, mailed Mar. 6, 2023, 15 pages. [cited by applicant]
Joubert et al., “Antibody-Drug Conjugates: The Last Decade,” Pharmaceuticals, 2020, 13, 245, 31 pages. [cited by applicant]
JP Office Action in Japanese Appln. No. 2020-557122, dated Nov. 22, 2022, 9 pages (with English translation). [cited by applicant]
Kalafatovic et al., “MMP-9 triggered self-assembly of doxorubicin nanofiber depots halts tumor growth,” Biomaterials, Aug. 2016, 98:192-202. [cited by applicant]
Karabadzhak et al., “pHLIP-FIRE, a Cell Insertion-Triggered Fluorescent Probe for Imaging Tumors Demonstrates Targeted Cargo Delivery In Vivo,” ACS Chem. Biol., Sep. 2014, 9(11):2545-5553. [cited by applicant]
Kerekes et al., “Aurora Kinase Inhibitors Based on the Imidazo[1,2-a]pyrazine Core: Fluorine and Deuterium Incorporation Improve Oral Absorption and Exposure,” Journal of Medicinal Chemistry, Jan. 2011, 54(1):201-210. [cited by applicant]
Kim et al., “Matrix metalloproteinase-inspired suicidal treatments of diabetic ulcers with siRNA-decorated nanofibrous meshes,” Gene Therapy, Apr. 2013, 20:378-385. [cited by applicant]
Kleiner-Grote et al., “Secretion of recombinant proteins from [cited by applicant]
Kolakowski et al., “The Methylene Alkoxy Carbamate Self-Immolative Unit: Utilization for the Targeted Delivery of Alcohol-Containing Payloads with Antibody-Drug Conjugates,” Angew. Chem. Int. Ed., Jul. 2016, 55(28):7948… [cited by applicant]
Kostova et al., “The Chemistry Behind ADCs,” Pharmaceuticals, May 2021, 14(5), 442, 46 pages. [cited by applicant]
Kumar et al., “Lipase catalysis in organic solvents: advantages and applications,” Biol. Proced. Online, Jan. 2016, 18(2):11 pages. [cited by applicant]
Kumazawa et al., “Potent and broad antitumor effects of DX-8951f, a water-soluble camptothecin derivative, against various human tumors xenografted in nude mice,” Cancer Chemotherapy and Pharmacology, Jul. 1998, 42(3):2… [cited by applicant]
Kurth et al., “A thioxanone-based chiral template: asymmetric induction in the [2,3]-sigmatropic rearrangement of sulfur ylides. Enantioselective preparation of C.beta.-chiral pent-4-enoic acids,” J. Org. Chem., Apr. 19… [cited by applicant]
Lewis Phillips et al., “Targeting HER2-Positive Breast Cancer with Trastuzumab-DM1, an Antibody-Cytotoxic Drug Conjugate,” Cancer Research, Nov. 2008, 68(22):9280-9290. [cited by applicant]
Li et al., “Synthesis and Evaluation of Camptothecin Antibody-Drug Conjugates,” ACS Medicinal Chemistry Letters, Sep. 2019, 10(10):1386-1392. [cited by applicant]
Li et al., “Topoisomerase I in Human Disease Pathogenesis and Treatments,” Genomics, Proteomics & Bioinformatics, Jun. 2016, 14(3):166-171. [cited by applicant]
Lopus, “Antibody-DM1 conjugates as cancer therapeutics,” Cancer Letters, Aug. 2011, 307(2):113-118. [cited by applicant]
Lu et al., “Linkers Having a Crucial Role in Antibody-Drug Conjugates,” Int. J. Mol. Sci., Apr. 2016, 17(4):1-22. [cited by applicant]
Mckertish et al., “Advances and Limitations of Antibody Drug Conjugates for Cancer,” Biomedicines, Jul. 2021, 9(8):872, 25 pages. [cited by applicant]
Merrifield, “Solid Phase Peptide Synthesis. I. The Synthesis of a Tetrapeptide,” Journal of the American Chemical Society, Jul. 1963, 85(14):2149-2154. [cited by applicant]
Miletic et al., “Immobilization of Candida antarctica lipase B on polystyrene nanoparticles,” Macromolecular Rapid Communications, Jan. 2010, 31(1):71-74. [cited by applicant]
Mistry et al., “Clinical Advances of Hypoxia-Activated Prodrugs in Combination With Radiation Therapy,” International Journal of Radiation: Oncology Biology Physics, Aug. 2017, 98(5):1183-1196. [cited by applicant]
Monaco et al., “Catalytic Asymmetric Synthesis of Thiols,” Journal of the American Chemical Society, Nov. 2014, 136(49):4 pages. [cited by applicant]
Moshinikova et al., “Antiproliferative Effect of pHILIP-Amanitin,” Biochemistry, Jan. 2013, 52(7):1171-1178. [cited by applicant]
Nakada et al., “Novel antibody drug conjugates containing exatecan derivative-based cytotoxic payloads,” Bioorganic & Medicinal Chemistry Letters, Mar. 2016, 26(6):4 pages. [cited by applicant]
Nguyen et al., “A Novel Soluble Peptide with pH-Responsive Membrane Insertion,” Biochemistry, Oct. 2015, 54(43):6567-6575. [cited by applicant]
Office Action in Singapore Appln. No. 11202200132S, dated Aug. 15, 2023, 8 pages. [cited by applicant]
Office Action in Singapore Appln. No. 11202200134V, dated Aug. 14, 2023, 10 pages. [cited by applicant]
Ogitani et al., “Wide application of a novel topoisomerase I inhibitor-based drug conjugation technology,” Bioorganic & Medicinal Chemistry Letters, Oct. 2016, 26(20):5069-5072. [cited by applicant]
Pacher et al., “Role of Poly(ADP-ribose) polymerase 1 (PARP-1) in Cardiovascular Diseases: The Therapeutic Potential of PARP Inhibitors,” Cardiovasc Drug Rev., Oct. 2007; 25(3): 235-260. [cited by applicant]
PARP Inhibitors for Cancer Therapy, Cancer Drug Discovery and Development, vol. 83, Curtin and Sharma (ed)., 2015, Part V, 475-579. [cited by applicant]
Pétursson, “Protecting Groups in Carbohydrate Chemistry,” Journal of Chemical Education, Nov. 1997, 74(11):1297-1303. [cited by applicant]
Reagan-Shaw et al., “Dose translation from animal to human studies revisited, ” The FASEB Journal, Mar. 2008, 22(3):659-661. [cited by applicant]
Simplicio et al., “Prodrugs for Amines,” Molecules, Mar. 2008, 13(3):519-547. [cited by applicant]
Son et al., “Therapeutic Effect of pHLIPmediated CEACAM6 Gene Silencing in Lung Adenocarcinoma,” Scientific Reports, Sep. 2019, 9(1):11607, 11 pages. [cited by applicant]
Sugimori et al., “Synthesis and Antitumor Activity of Ring A- and F-Modified Hexacyclic Camptothecin Analogues,” J. Med. Chem., Jun. 1998, 41(13):2308-2318. [cited by applicant]
Tahara et al., “The Use of Olaparib (AZD2281) Potentiates SN-38 Cytotoxicity in Colon Cancer Cells by Indirect Inhibition of Rad51-Mediated Repair of DNA Double-Strand Breaks,” Molecular Cancer Therapeutics, May 2014, 1… [cited by applicant]
Tangutur, “Microtubule Targeting Agents as Cancer Chemotherapeutics: An Overview of Molecular Hybrids as Stabilizing and Destabilizing Agents,” Curr Top Med Chem, Sep. 2017, 17(22):2523-2537. [cited by applicant]
Tannock et al., “Acid pH in tumors and its potential for therapeutic exploitation,” Cancer Res., Aug. 1989, 49(16):4373-4384, 13 pages. [cited by applicant]
Tesauro et al., “Peptide-Based Drug-Delivery Systems in Biotechnological Applications: Recent Advances and Perspectives,” Molecules, Jan. 2019, 24(2):27 pages. [cited by applicant]
Vasquez-Montes et al., “Divalent Cations and Lipid Composition Modulate Membrane Insertion and Cancer-Targeting Action of pHLIP,” Journal of Molecular Biology, Dec. 2019, 431(24):5004-5018. [cited by applicant]
Vrettos et al., “On the design principles of peptide-drug conjugates for targeted drug delivery to the malignant tumor site,” Beilstein J. Org. Chem., Apr. 2018, 14:930-954. [cited by applicant]
Wang et al., “Development and Characterization of a Novel Peptide—Drug Conjugate with DM1 for Treatment of FGFR2-Positive Tumors,” Biomedicines, Jul. 2021, 9(8):849, 14 pages. [cited by applicant]
Weerakkody et al., “Family of pH (low) insertion peptides for tumor targeting,” Proceedings of the National Academy of Sciences, Apr. 2013, 110(15):5834-5839. [cited by applicant]
White et al., “Discovery of an SSTR2-Targeting Maytansinoid Conjugate (PEN-221) with Potent Activity in Vitro and in Vivo,” J. Med. Chem., Mar. 2019, 62(5):2708-2719. [cited by applicant]
Wickstrom et al., “Melflufen—a peptidase-potentiated alkylating agent in clinical trials,” Oncotarget, Sep. 2017, 8(39):66641-66655. [cited by applicant]
Widdison et al.. “Semisynthetic Maytansine Analogues for the Targeted Treatment of Cancer,” Journal of Medicinal Chemistry, Jun. 2006, 49(14):4392-4408. [cited by applicant]
Wyatt et al., “Peptides of pHLIP family for targeted intracellular and extracellular delivery of cargo molecules to tumors,” Proceedings of the National Academy of Sciences, Mar. 2018, 115(12):E2811-E2818. [cited by applicant]
Xu et al., “Design, synthesis and biological evaluation of deuterated nintedanib for improving pharmacokinetic properties,” Journal of Labelled Compounds and Radiopharmaceuticals, Jun. 2015, 58(7):308-312. [cited by applicant]
Yang et al., “Enzyme-mediated hydrolytic activation of prodrugs,” Acta Pharamaceutica Sinica B, Oct. 2011, 1(3):143-159. [cited by applicant]
Yao et al., “MMP-Responsive ‘Smart’ Drug Delivery and Tumor Targeting,” Trends in Pharmacological Sciences, Aug. 2018, 39(8):766-781. [cited by applicant]
Zdarta et al., “A General Overview of Support Materials for Enzyme Immobilization: Characteristics, Properties, Practical Utility,” Catalysts, Feb. 2018, 8(92):1-27. [cited by applicant]
Zhang et al., “Design of acid-activated cell penetrating peptide for delivery of active molecules into cancer cells,” Bioconjugate Chemistry, American Chemical Society, Jul. 2011, 22(7):1410-1415. [cited by applicant]
Zhang et al., “Linker Immolation Determines Cell Killing Activity of Disulfide—Linked Pyrrolobenzodiazepine Antibody-Drug Conjugates,” ACS Medicinal Chemistry Letters, Aug. 2016, 7(11):6 pages. [cited by applicant]
Zhao et al., “Recombinant production of medium-to large-sized peptides in [cited by applicant]
Zhong et al., “Cathepsin B-cleavable doxorubicin prodrugs for targeted cancer therapy (Review), ” International Journal of Oncology, Feb. 2013, 42(2):373-383. [cited by applicant]