IP Library Patent Application 18246304
Patent Application
App. No. 18/246,304

METHODS OF PRODUCING EXTRACELLULAR VESICLES

Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US None
App. No.
18/246,304
Abstract

The present disclosure relates to extracellular vesicles (EVs), e.g., exosomes, which can be rapidly modified to comprise an antigen of interest, and the uses of such EVs as vaccines for the treatment of wide range of diseases or disorders. Also provided herein are methods for preparing and manufacturing such EVs for use as vaccines.

Claims (57)

1 . A method of manufacturing a vaccine for a disease or disorder comprising, preparing an extracellular vesicle (EV) for the vaccine, comprising loading an antigen to the EV that has been isolated from a producer cell, wherein the disease or disorder comprises an infectious disease.

2 - 3 . (canceled)

4 . The method of claim 1 , wherein the antigen is: (i) linked to the exterior surface of the EV, (ii) linked to the luminal surface of the EV, (iii) in the lumen of the EV, or (iv) any combination thereof, wherein after the loading of the antigen, the EV is capable of inducing a T-cell immune response, a B-cell immune response, a NK response, or a combination thereof, wherein the antigen comprises a single epitope of an antigen, or a concatemer of multiple epitopes of an antigen.

5 . The method of claim 1 , to wherein the EV further comprises an adjuvant, wherein the adjuvant comprises a non-toxic mutant of diphtheria toxin (e.g., CRM-197), peptide adjuvant (e.g., muramyl dipeptide (MDP)), STING agonist, TLR agonist, universal T cell helper peptide (e.g., PADRE), or any combinations thereof.

6 - 10 . (canceled)

11 . The method of claim 5 , wherein the antigen and/or the adjuvant is linked to the exterior surface and/or the luminal surface of the EV by an anchoring moiety, affinity agent, chemical conjugation, cell penetrating peptide (CPP), split intein, SpyTag/SpyCatcher, ALFA-tag, Streptavidin/Avitag, Sortase, SNAP-tag, ProA/Fc-binding peptide, or any combinations thereof.

12 . The method of claim 11 , wherein the anchoring moiety comprises a sterol (e.g., cholesterol), GM1, lipid (e.g., fatty acid (e.g., palmitate), ionizable lipid, glycerophospholipid, sphingolipid), vitamin (e.g., tocopherol (e.g., vitamin E), vitamin A, vitamin D, vitamin K), alkyl chain, aromatic ring, small molecule, peptide, including any derivatives thereof, or any combination thereof, wherein the anchoring moiety is attached to the antigen and/or adjuvant by a linker, wherein the linker comprises:

(i) a polypeptide linker, non-polypeptide linker, or both;

(ii) a hydrophilic linker (e.g., PEG and derivatives);

(iii) a hydrophobic linker (e.g., alkyl chain, hexamethylene);

(iv) a cleavable linker (e.g., phosphodiesters, valine citrulline, disulfide bond, acid-labile); or

(v) any combination of (i) to (iv).

13 - 17 . (canceled)

18 . The method of claim 11 , wherein the chemical conjugation comprises a maleimide moiety, copper-free, biorthogonal click chemistry (e.g., azide/strained alkyne (DIFO, dibenzocyclooctyne (DBCO), bicyclononyne (BCN)), metal-catalyzed click chemistry (e.g., CuAAC, RuAAC), or any combination thereof.

19 . The method of claim 1 , wherein the antigen comprises a peptide, wherein the peptide:

(i) comprises a natural peptide, synthetic peptide, or both;

(ii) comprises a lysine, wherein the lysine is a N-terminal lysine;

(iii) comprises unnatural amino acids with side chains that allow for the binding of an azide, strained alkynes, maleimide, pentafluorophenyl (PFP) esters, or NHS;

(iv) is less than about 150 amino acids in length, less than about 140 amino acids in length, less than about 130 amino acids in length, less than about 120 amino acids in length, less than about 110 amino acids in length, less than about 100 amino acids in length, less than about 90 amino acids in length, less than about 80 amino acids in length, less than about 70 amino acids in length, less than about 60 amino acids in length, less than about 50 amino acids in length, less than about 40 amino acids in length, less than about 30 amino acids in length, less than about 20 amino acids in length, or less than about 10 amino acids in length;

(v) comprises a linear epitope of the protein from which it is derived, a conformational epitope, or both; or

(vi) any combination of (i) to (v).

20 - 33 . (canceled)

34 . The method of claim 1 , wherein the antigen is derived from a virus causing a pandemic, wherein the virus is a coronavirus, an influenza virus, an Ebola virus, a Chikungunya virus (CHIKV), a Crimean-Congo hemorrhagic fever (CCGF) virus, a Hendra virus, a Lassa virus, a Marburg virus, a monkeypox virus, a Nipah virus, a Hendra virus, a Rift Valley fever (RVF) virus, a Variola virus, a yellow fever virus, a Zika virus, a measles virus, a human immunodeficiency virus (HIV), a hepatitis C virus (HCV), a dengue fever virus (DENV), a parvovirus (e.g., B19 virus), a norovirus, a respiratory syncytial virus (RSV), a lentivirus, an adenovirus, a flavivirus, a filovirus, an alphavirus (e.g., a rhinovirus), a human papillomavirus (HPV), Eastern equine encephalitis (EEE), West Nile virus, Epstein Barr virus (EBV), Cytomegalovirus (CMV), Hepatitis B virus (HBV), John Cunningham virus (JCV), Japanese and tick-borne encephalitis, encephalitic equine viruses, Human Metapneumovirus (hMPV), rabies, or any combination thereof.

35 - 38 . (canceled)

39 . The method of claim 1 , wherein the antigen:

(i) is a universal SARS coronavirus antigen;

(ii) comprises a CD8+ T cell epitope selected from LITGRLQSL (SEQ ID NO: 423), FIAGLIAIV (SEQ ID NO: 425), RLNEVAKNL (SEQ ID NO: 439), VVFLHVTYV (SEQ ID NO: 427), VLNDILSRL (SEQ ID NO: 429), ALNTLVKQL (SEQ ID NO: 445, NLNESLIDL (SEQ ID NO: 431), MEVTPSGTWL (SEQ ID NO: 451), GMSRIGMEV (SEQ ID NO: 452), ILLNKHIDA (SEQ ID NO: 453), ALNTPKDHI (SEQ ID NO: 454), LALLLLDRL (SEQ ID NO: 457), LLLDRLNQL (SEQ ID NO: 458, LQLPQGTTL (SEQ ID NO: 460), RLNQLESKV (SEQ ID NO: 448), or any combination thereof;

(iii) comprises a CD8+ T cell epitope selected from FIAGLIAIV (SEQ ID NO: 425), LITGRLQSL (SEQ ID NO: 423), RLNEVAKNL (SEQ ID NO: 439), NLNESLIDL (SEQ ID NO: 431), ALNTLVKQL (SEQ ID NO: 445), or any combination thereof;

(iv) comprises a CD4+ T cell epitope having the amino acid sequence AKFVAAWTLKAAA (SEQ ID NO: 382);

(v) comprises a B cell epitope selected from TESNKKFLPFQQFGRDIA (SEQ ID NO: 582), PSKPSKRSFIEDLLFNKV (SEQ ID NO: 583), or both;

(vi) comprises both T cell and B cell epitopes;

(vii) comprises the amino acid sequence VLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQL SSNFGAISS (SEQ ID NO: 584), GAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVT (SEQ ID NO: 585), or

both; or

(viii) any combination of (i) to (vii).

40 - 45 . (canceled)

46 . The method of claim 1 , wherein the loading of the antigen and/or adjuvant to the EV occurs at least about 1 day, at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about 2 years, at least about 3 years, at least about 4 years, at least about 5 years, at least 6 years, at least 7 years, at least 8 years, at least 9 years, at least 10 years, at least 15 years, at least 20 years, at least 25 years or more after isolating the EV from the producer cell.

47 . The method of claim 1 , wherein the loading efficiency of the antigen and/or adjuvant to the EVs is increased compared to a reference loading efficiency (e.g., loading efficiency of the antigen and/or adjuvant without the use of an anchoring moiety, affinity agent, chemical conjugation, cell penetrating peptide (CPP), split intein, SpyTag/SpyCatcher, ALFA-tag, Streptavidin/Avitag, Sortase, SNAP-tag, ProA/Fc-binding peptide, or any combinations thereof), wherein the loading efficiency is increased by at least about 1-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at least about 80-fold, at least about 90-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, at least about 2,000-fold, at least about 3,000-fold, at least about 4,000-fold, at least about 5,000-fold, at least about 6,000-fold, at least about 7,000-fold, at least about 8,000-fold, at least about 9,000-fold, at least about 10,000-fold or more, compared to the reference loading efficiency.

48 . (canceled)

49 . The method of claim 1 , wherein the time required for manufacturing the vaccine (“manufacturing time”) is reduced compared to a reference manufacturing time (e.g., manufacturing time of a method wherein the loading of the antigen occurs by introducing the antigen into the producer cell, or manufacturing time of a method for producing a vaccine that does not comprise an EV, such as a traditional peptide vaccine), wherein the manufacturing time is reduced by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or at least about 90% or more, compared to the reference manufacturing time; and is less than about 12 months, less than about 11 months, less than about 10 months, less than about 9 months, less than about 8 months, less than about 7 months, less than about 6 months, less than about 5 months, less than about 4 months, less than about 3 months, less than about 2 months, or less than about 1 month.

50 - 52 . (canceled)

53 . The method of claim 1 , wherein the EV further comprises a first scaffold moiety, wherein the antigen is linked to the first scaffold moiety on the exterior surface of the base EV.

54 . The method of claim 53 , wherein the EV comprises the first scaffold moiety prior to the loading of the antigen to the EV.

55 - 56 . (canceled)

57 . The method of claim 53 , wherein the EV further comprises a second scaffold moiety.

58 . The method of claim 57 , wherein the EV comprises the second scaffold moiety prior to the loading of the antigen to the EV, wherein the antigen is linked to the first scaffold moiety, and the adjuvant is linked to the second scaffold moiety, wherein the first scaffold moiety and the second scaffold moiety are the same or different, wherein the antigen is linked to a first scaffold moiety on the exterior surface of the base EV, and the adjuvant is:

(i) linked to a second scaffold moiety on the exterior surface of the base EV;

(ii) linked to a second scaffold moiety on the luminal surface of the base EV;

(iii) in the lumen of the EV; or

(iv) any combination of (i), (ii), and (iii).

59 - 61 . (canceled)

62 . The method of claim 58 , wherein the first or second scaffold moiety is a Scaffold X comprising a prostaglandin F2 receptor negative regulator (the PTGFRN protein); basigin (the BSG protein); immunoglobulin superfamily member 2 (the IGSF2 protein); immunoglobulin superfamily member 3 (the IGSF3 protein); immunoglobulin superfamily member 8 (the IGSF8 protein); integrin beta-1 (the ITGB1 protein); integrin alpha-4 (the ITGA4 protein); 4F2 cell-surface antigen heavy chain (the SLC3A2 protein); a class of ATP transporter proteins (the ATP1A1, ATP1A2, ATP1A3, ATP1A4, ATP1B3, ATP2B1, ATP2B2, ATP2B3, ATP2B4 proteins), or any combination thereof.

63 . The method of claim 58 , wherein the first or second scaffold moiety is a Scaffold Y comprising myristoylated alanine rich Protein Kinase C substrate (the MARCKS protein); myristoylated alanine rich Protein Kinase C substrate like 1 (the MARCKSL1 protein); brain acid soluble protein 1 (the BASP1 protein), or any combination thereof.

64 - 70 . (canceled)

71 . The method of claim 1 , wherein the EV further comprises a targeting moiety, wherein the targeting moiety is loaded before, after, or together with the loading of the antigen.

72 - 81 . (canceled)

82 . A method of treating a disease or disorder in a subject in need thereof, comprising administering the EV of claim 1 to the subject.

83 - 84 . (canceled)

Assignments (2)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Dec 5, 2023
From: SOOS, TIM; NOYES, AARON; DOOLEY, KEVIN P.; ZHANG, ERIC
To: CODIAK BIOSCIENCES, INC.
Reel/Frame 065767/0348 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jul 11, 2023
From: CODIAK BIOSCIENCES, INC.
To: LONZA SALES AG
Reel/Frame 064251/0794 →