IP Library Granted Patent US 12,540,168
Granted Patent B2
US 12,540,168 · App. 18/661,201 · Granted Feb 3, 2026

Human amylin analog polypeptides and methods of use

Inventors: William Blackwell (Cambridge, MA); Ved P. Srivastava (Cambridge, MA); James M. Way (Cambridge, MA)
Assignee: I2O Therapeutics, Inc.
C07K14/575A61K9/0004A61K9/0019A61P3/04A61P3/10A61K38/00
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 12,540,168
App. No.
18/661,201
Granted
Feb 3, 2026
Kind
B2
Abstract

This invention relates to isolated polypeptides that are analogs of human amylin. The disclosed amylin analog polypeptides have beneficial physicochemical properties relative to endogenous amylin, such as longer elimination half-lives (t 1/2 ) and improved solubility and thermal stability. This invention also relates to methods of using presently disclosed amylin analog polypeptides in a variety of therapeutic indications, as well as methods of producing the same. The disclosed amylin analog polypeptides are particularly useful in methods of treating metabolic diseases or disorders, such as types 1 and 2 diabetes, and providing weight loss.

Claims (119)

1 . A method of treating obesity in a human subject, providing weight loss to the human subject, or suppressing appetite in the human subject, comprising administering to the subject a pharmaceutical composition comprising an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 203:

(SEQ ID NO: 203)

X 1 CNTX 5 TCATX 10 RLANX 15 X 16 X 17 X 18 SSNNFGPILPPTKVGSETY-

(OH/NH 2 ),

or a pharmaceutically acceptable salt thereof, wherein:

X 1 is S, k, or K;

X 5 is S;

X 10 is Q or S;

X 15 is E or F;

X 16 is L;

X 17 is H, V, and Q; and

X 18 is K, H, or R;

each K independently represents an L-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;

each k independently represents a D-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer; and

wherein the two cysteine residues of X 1 CNTX 5 TC (SEQ ID NO: 308) are optionally further bound by a disulfide bridge.

2 . The method of claim 1 , wherein the isolated polypeptide comprises the amino acid sequence of SEQ ID NO:209: X 1 CNTSTCATX 10 RLANX 15 X 16 X 17 KSSNNFGPILPPTKVGSETY-(OH/NH 2 ) (SEQ ID NO:209), or a pharmaceutically acceptable salt thereof, wherein:

X 1 is Kor k;

X 10 is Q or S;

X 15 is E or F;

X 16 is L; and

X 17 is H, V or Q;

each K independently represents an L-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;

each k independently represents a D-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer; and

wherein the two cysteine residues of X 1 CNTSTC (SEQ ID NO: 318) are optionally further bound by a disulfide bridge.

3 . The method of claim 1 , wherein the isolated polypeptide comprises the amino acid sequence of:

(SEQ ID NO: 130)

KC*NTSTC*ATQRLANELHKSSNNFGPILPPTKVGSETY-(NH 2 ),

or a pharmaceutically acceptable salt thereof,

wherein the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

4 . The method of claim 1 , wherein the isolated polypeptide comprises the amino acid sequence of:

(SEQ ID NO: 64)

K*((γGlu) 2 (CO(CH 2 ) 18 CO 2 H))C*NTSTC*ATQRLANELHKSSNN

FGPILPPTKVGSETY-(NH 2 ),

or a pharmaceutically acceptable salt thereof,

wherein:

K* represents an L-lysine covalently bound to (γGlu) 2 (CO(CH 2 ) 18 CO 2 H); and

the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

5 . The method of claim 1 , wherein the isolated polypeptide comprises a lipophilic substituent.

6 . The method of claim 1 , wherein the isolated polypeptide comprises the amino acid sequence of:

(SEQ ID NO: 65)

K*((γGlu) 2 (CO(CH 2 ) 16 CO 2 H))C*NTSTC*ATQRLANELHKSSNN

FGPILPPTKVGSETY-(NH 2 ),

or a pharmaceutically acceptable salt thereof,

wherein:

K* represents an L-lysine covalently bound to (γGlu) 2 (CO(CH 2 ) 16 CO 2 H); and

the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

7 . The method of claim 1 , wherein the isolated polypeptide comprises the amino acid sequence of:

(SEQ ID NO: 131)

KC*NTSTC*ATQRLANFLQKSSNNFGPILPPTKVGSETY-(NH 2 ),

or a pharmaceutically acceptable salt thereof,

wherein the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

8 . The method of claim 1 , wherein the isolated polypeptide comprises the amino acid sequence of:

(SEQ ID NO: 109)

K*(γGlu-CO(CH 2 ) 16 CO 2 H)C*NTSTC*ATSRLANFLQKSSNNF 

GPILPPTKVGSETY-NH 2 ,

or a pharmaceutically acceptable salt thereof,

wherein:

K* represents an L-lysine covalently bound to γGlu-CO(CH 2 ) 16 CO 2 H; and

the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

9 . The method of claim 1 , wherein the isolated polypeptide consists of the amino acid sequence of:

(SEQ ID NO: 130)

KC*NTSTC*ATQRLANELHKSSNNFGPILPPTKVGSETY-(NH 2 ),

or a pharmaceutically acceptable salt thereof,

wherein the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

10 . The method of claim 1 , wherein the isolated polypeptide consists of the amino acid sequence of:

(SEQ ID NO: 64)

K*((γGlu) 2 (CO(CH 2 ) 18 CO 2 H))C*NTSTC*ATQRLANELHKSSNN

FGPILPPTKVGSETY-(NH 2 ),

or a pharmaceutically acceptable salt thereof,

wherein:

K* represents an L-lysine covalently bound to (γGlu) 2 (CO(CH 2 ) 18 CO 2 H); and

the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

11 . The method of claim 1 , wherein the isolated polypeptide consists of the amino acid sequence of:

(SEQ ID NO: 65)

K*((γGlu) 2 (CO(CH 2 ) 16 CO 2 H))C*NTSTC*ATQRLANELHKSSNN

FGPILPPTKVGSETY-(NH 2 ),

or a pharmaceutically acceptable salt thereof,

wherein:

K* represents an L-lysine covalently bound to (γGlu) 2 (CO(CH 2 ) 16 CO 2 H); and

the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

12 . The method of claim 1 , wherein the isolated polypeptide consists of the amino acid sequence of:

(SEQ ID NO: 131)

KC*NTSTC*ATQRLANFLQKSSNNFGPILPPTKVGSETY-(NH 2 ),

or a pharmaceutically acceptable salt thereof,

wherein the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

13 . The method of claim 1 , wherein the isolated polypeptide consists of the amino acid sequence of:

(SEQ ID NO: 109)

K*(γGlu-CO(CH 2 ) 16 CO 2 H)C*NTSTC*ATSRLANFLQKSSNNF 

GPILPPTKVGSETY-NH 2 ,

or a pharmaceutically acceptable salt thereof,

wherein:

K* represents an L-lysine covalently bound to γGlu-CO(CH 2 ) 16 CO 2 H; and

the two cysteine residues denoted C* at positions 2 and 7 are further bound by a disulfide bridge.

14 . The method of claim 1 , wherein the isolated polypeptide comprises an amino acid sequence selected from the group consisting of any one of SEQ ID NOS: 55, 64, 65, 109, 112-120, 126, 130, 131, and 143, or a pharmaceutically acceptable salt thereof.

15 . The method of claim 1 , wherein the isolated polypeptide comprises a lipophilic substituent and a spacer of Formula VI:

Formula VI

—(Y1) n1 —(V) r —(Y2) n2 —CO—(CH 2 ) m —Z

wherein

Z is —CH 3 or —CO 2 H;

m is from 4 to 24;

Y1 is selected from the group consisting of γGlu, Asp, and Gly;

Y2 is selected from the group consisting of γGlu, Asp, and Gly;

V is —[COCH 2 (O(CH 2 ) 2 ) t OCH 2 NH]—, and t is from 1 to 8;

r is from 1 to 8;

n1 is from 0 to 10; and

n2 is from 0 to 10.

16 . The method of claim 1 , wherein the isolated polypeptide comprises a lipophilic substituent and a spacer of Formula III:

Formula III

—(γGlu) n —CO—(CH 2 ) m —Z(″(γGlu)n″ disclosed as 

SEQ ID NO: 311)

wherein

Z is —CH 3 or —CO 2 H;

m is from 4 to 24; and

n is from 1 to 10.

17 . The method of claim 15 , wherein the lipophilic substituent, —CO—(CH 2 ) m —Z, is linked to the s-amino group of a lysine of the isolated polypeptide via the spacer, —(Y1) n1 —(V) r —(Y2) n2 —, which spacer forms a bridge between the amino group of the disclosed polypeptide and the CO— group of the lipophilic substituent.

18 . The method of claim 16 , wherein the lipophilic substituent, —CO—(CH 2 ) m —Z, is linked to the ε-amino group of a lysine of the isolated polypeptide via the spacer, -(γGlu) n -(“(γGlu) n ” disclosed as SEQ ID NO: 311), which spacer forms a bridge between the amino group of the disclosed polypeptide and the CO— group of the lipophilic substituent.

19 . The method of claim 5 , or a pharmaceutically acceptable salt thereof, wherein:

the lipophilic substituent is —CO—(CH 2 ) m —CO 2 H; and

m is from 14 to 20.

Assignments (3)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Dec 29, 2025
From: BLACKWELL, WILLIAM; SRIVASTAVA, VED P.; WAY, JAMES M.
To: INTARCIA THERAPEUTICS, INC.
Reel/Frame 073329/0420 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Dec 29, 2025
From: INTARCIA (ASSIGNMENT FOR THE BENEFIT OF CREDITORS), LLC
To: I2O THERAPEUTICS, INC.
Reel/Frame 074120/0756 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Dec 29, 2025
From: INTARCIA THERAPEUTICS, INC.
To: INTARCIA (ASSIGNMENT FOR THE BENEFIT OF CREDITORS), LLC
Reel/Frame 074120/0836 →
Continuity (3)
Division 16598915 · Oct 10, 2019
Provisional Application 62744236 · Oct 11, 2018
Related Publication 20240417438A1 · Dec 19, 2024
References Cited (295)
US 5321008A · Beaumont et al. · 1994 [cited by applicant]
US 5739106A · Rink et al. · 1998 [cited by applicant]
US 8486890B2 · Hansen · 2013 [cited by examiner]
US 8497347B2 · Mehta et al. · 2013 [cited by applicant]
US 8895504B2 · Schaffer et al. · 2014 [cited by applicant]
US 9023789B2 · Dahl et al. · 2015 [cited by applicant]
US 9593149B2 · Kruse et al. · 2017 [cited by applicant]
US 10071140B2 · Mathiesen et al. · 2018 [cited by applicant]
US 20050070472A1 · Gedulin et al. · 2005 [cited by applicant]
US 20090099085A1 · Hansen et al. · 2009 [cited by applicant]
US 20100311650A1 · Mehta et al. · 2010 [cited by applicant]
US 20120046224A1 · Karsdal et al. · 2012 [cited by applicant]
US 20140018286A1 · Schaeffer et al. · 2014 [cited by applicant]
US 20160272683A1 · Kruse et al. · 2016 [cited by applicant]
WO WO2010046357A1 · 2010 [cited by applicant]
WO WO2011130499A1 · 2011 [cited by applicant]
WO WO2012162547A2 · 2012 [cited by applicant]
WO WO2015155151A1 · 2015 [cited by applicant]
WO WO2016034604A1 · 2016 [cited by applicant]
WO WO2016146739A1 · 2016 [cited by applicant]
“A Breakthrough Opportunity for SYMLIN: Dual Hormone Pump with Independent Hormone Algorithms”, 13 pages (Mar. 2014). [cited by applicant]
American Diabetes Association, “8. Pharmacologic Approaches to Glycemic Treatment: Standards of Medical Care in Diabetes—2018”, [cited by applicant]
Center for Drug Evaluation and Research Approval Package for Application No. 21-332, Pharmacology Review(s), 179 pages (2005). [cited by applicant]
Decision Resources, Inc.—Metabolic Disorders Study #1—“Type 1 Diabetes”, 153 pages (Aug. 2008). [cited by applicant]
Decision Resources, Inc.—Decision Base 2009—“Type 1 Diabetes: Opportunities Await Therapies That Offer Alternatives to Subcutaneous Injections of Insulins” 103 pages (2009). [cited by applicant]
“Blood Glucose Instability is the Achilles Heel of T1D Therapy” 9 pages (May 8, 2014). [cited by applicant]
Highlights of Prescribing Information—Symlin (Jun. 2014). [cited by applicant]
IDF Diabetes Atlas, Sixth edition ISBN: 2-930299-85-3 (2013). [cited by applicant]
The Diabetes Control and Complications Trial Research Group “Lifetime Benefits and Costs of Intensive Therapy as Practiced in the Diabetes Control and Complications Trial”, [cited by applicant]
Ozempic—semaglutide injection 0.5mg/1mg—Highlights of Prescribing Information. (2017). [cited by applicant]
Pharmacology and Toxicology Summary—NDA 21-332 Symlin. 12 pages. [cited by applicant]
Symlin (pramlintide acetate) injection, prescribing information, 6 pages (2008). [cited by applicant]
Symlin® highlights of prescribing information, 29 pages (Apr. 2016). [cited by applicant]
Adler et al., “Neuroprotective effects of the amylin analogue pramlintide on Alzheimer's disease pathogenesis and cognition”, [cited by applicant]
Alrefai et al., “Pramlintide: Clinical Strategies for Success”, [cited by applicant]
Amiel et al., “Defective Glucose Counterregulation After Strict Glycemic Control of Insulin-Dependent Diabetes Mellitus”, [cited by applicant]
Anderson et al., “Optimal management of type 2 diabetes in patients with increased risk of hypoglycemia”, [cited by applicant]
Andreassen et al., “Prolonged Calcitonin Receptor Signaling by Salmon, but Not Human Calcitonin, Reveals Ligand Bias”, [cited by applicant]
Andreassen et al., “A novel oral dual amylin and calcitonin receptor agonist (KBP-042) exerts antiobesity and antidiabetic effects in rats”, [cited by applicant]
Armour et al., “Pharmacological characterization of receptor-activity-modifying proteins (RAMPs) and the human calcitonin receptor”, [cited by applicant]
Aronne et al., “Progressive Reduction in Body Weight after Treatment with the Amylin Analog Pramlintide in Obese Subjects: A Phase 2, Randomized, Placebo-Controlled, Dose-Escalation Study”, [cited by applicant]
Aronne et al., “Enhanced Weight Loss Following Coadministration of pramlintide With sibutramine or phentermine in a Multicenter trial”, [cited by applicant]
Aviles-Olmos et al., “Exenatide and the treatment of patients with Parkinson's disease”, [cited by applicant]
Bailey et al., “Pharmacological characterization of rat amylin receptors: implications for the identification of amylin receptor subtypes”, [cited by applicant]
Baisley et al., “Antipsychotic-Like Actions of the Satiety Peptide, Amylin, in Ventral Striatal Regions Marked by Overlapping Calcitonin Receptor and RAMP-1 Gene Expression”, [cited by applicant]
Bakhtiani et al., “A review of artificial pancreas technologies with an emphasis on bi-hormonal therapy”, [cited by applicant]
Bansal et al., “Insulin as a physiological modulator of glucagon secretion”, [cited by applicant]
Beaumont et al., “Regulation of muscle glycogen metabolism by CGRP and amylin: CGRP receptors not involved”, [cited by applicant]
Bello et al., “Dose combinations of exendin-4 and salmon calcitonin produce additive and synergistic reductions in food intake in nonhuman primates”, [cited by applicant]
Bergenstal et al., “Lack of Glucagon Response to Hypoglycemia in Type I Diabetics After Long-Term Optimal Therapy with a Continuous Subcutaneous insulin infusion pump”, [cited by applicant]
Bettge et al., “Occurrence of nausea, vomiting and diarrhoea reported as adverse events in clinical trials studying glucagon-like peptide-1 receptor agonists: A systematic analysis of published clinical trials”, [cited by applicant]
Bettge et al., “Occurrence of nausea, vomiting and diarrhoea reported as adverse events in clinical trials studying glucagon-like peptide-1 receptor agonists: A systematic analysis of published clinical trials—Supplemen… [cited by applicant]
Bode et al., “Glycemic Characteristics in Continuously Monitored Patients With Type 1 and Type 2 Diabetes”, [cited by applicant]
Bolli et al., “Defective Glucose Counterregulation After Subcutaneous Insulin in Noninsulin-dependent Diabetes Mellitus; Paradoxical Suppression of Glucose Utilization and Lack of Compensatory Increase in Glucose Produc… [cited by applicant]
Bolli et al., “Abnormal Glucose Counterregulation After Subcutaneous Insulin In Insulin-Dependent Diabetes Mellitus”, [cited by applicant]
Bolli et al. “Abnormal Glucose Counterregulation in Insulin-dependent Diabetes Mellitus”, [cited by applicant]
Bolli et al., “A Reliable and Reproducible Test for Adequate Glucose Counterregulation in Type I Diabetes Mellitus”, [cited by applicant]
Booe et al., “Structural Basis for Receptor Activity-Modifying Protein-Dependent Selective Peptide Recognition by a G Protein-Coupled Receptor”, [cited by applicant]
Bower et al., “Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development”, [cited by applicant]
Boyle et al., “Brain Glucose Uptake and Unawareness of Hypoglycemia in Patients with Insulin-Dependent Diabetes Mellitus”, [cited by applicant]
Boyle et al., “Amylin - Its role in the homeostatic and hedonic control of eating and recent developments of amylin analogs to treat obesity”, [cited by applicant]
Brod et al., “The Impact of Non-Severe Hypoglycemic Events on Work Productivity and Diabetes Management”, [cited by applicant]
Brown et al., “All-Cause Mortality in the Canterbury (New Zealand) Insulin-Treated Diabetic Registry Population”, [cited by applicant]
Chan et al., “It Takes Two to Tango: Combined Amylin/Leptin Agonism as a Potential Approach to Obesity Drug Development”, [cited by applicant]
Chapman et al., “Effect of pramlintide on satiety and food intake in obese subjects and subjects with type 2 diabetes”, [cited by applicant]
Chase et al., “Pramlintide Lowered Glucose Excursions and Was Well-Tolerated in Adolescents with Type 1 Diabetes: Results from a Randomized, Single-Blind, Placebo-Controlled, Crossover Study”, [cited by applicant]
Chaturvedula et al., “In vivo iontophoretic delivery and pharmacokinetics of salmon calcitonin”, [cited by applicant]
Cheng et al., “Coffee Components Inhibit Amyloid Formation of Human Islet Amyloid Polypeptide in Vitro: Possible Link between Coffee Consumption and Diabetes Mellitus”, [cited by applicant]
Cheng et al., “Calcitonin Receptor Neurons in the Mouse Nucleus Tractus Solitarius Control Energy Balance via the Non-aversive Suppression of Feeding”, [cited by applicant]
Chiang et al., “Type 1 Diabetes Through the Life Span: A Position Statement of the American Diabetes Association”, [cited by applicant]
Childs, “Pramlintide Use in Type 1 Diabetes Resulting in Less Hypoglycemia”, [cited by applicant]
Christopoulos et al., “Multiple Amylin Receptors Arise from Receptor Activity-Modifying Protein Interaction with the Calcitonin Receptor Gene Product”, [cited by applicant]
Clodi et al., “Distribution and kinetics of amylin in humans”, [cited by applicant]
Coester et al., “RAMP1 and RAMP3 differentially control amylin's effects on food intake, glucose and energy balance in male and female mice”, [cited by applicant]
Colburn et al., “Pharmacokinetics and Pharmacodynamics of AC137 (25,28,29 Tripro-Amylin, Human) After Intravenous Bolus and Infusion Doses in Patients with Insulin-Dependent Diabetes”, [cited by applicant]
Cowie et al., “Disparities in incidence of diabetic end-stage renal disease according to race and type of diabetes”, [cited by applicant]
Cryer, “Hypoglycaemia: The limiting factor in the glycaemic management of Type I and Type II Diabetes”, [cited by applicant]
Cryer, “Glycemic Goals in Diabetes: Trade-off Between Glycemic Control and latrogenic Hypoglycemia”, [cited by applicant]
Cummins et al., “Clinical effectiveness and cost-effectiveness of continuous subcutaneous insulin infusion for diabetes: systematic review and economic evaluation”, [cited by applicant]
Curkendall et al., “Incidence and Cost of Hypoglycemia Among Patients with Type 2 Diabetes in the United States: Analysis of a Health Insurance Database”, [cited by applicant]
Dagogo-Jack et al., “Hypoglycemia-associated Autonomic Failure in Insulin-dependent Diabetes Mellitus”, [cited by applicant]
Dal Maso et al., “Extracellular loops 2 and 3 of the calcitonin receptor selectively modify agonist binding and efficacy”, [cited by applicant]
Davis et al., “Hypoglycemia—The Major Barrier to Good Glycemic Control”, [cited by applicant]
Deems et al., “Amylin Activates Glycogen Phosphorylase and Inactivates Glycogen Synthase via a cAMP-Independent Mechanism”, [cited by applicant]
Defronzo et al., “Effects of Exenatide (Exendin-4) on Glycemic Control and Weight Over 30 Weeks in Metformin-Treated Patients With Type 2 Diabetes”, [cited by applicant]
Devendra et al., “Type 1 diabetes: recent developments”, [cited by applicant]
Edelman et al., “A Double-Blind, Placebo-Controlled Trial Assessing Pramlintide Treatment in the Setting of Intensive Insulin Therapy in Type 1 Diabetes”, [cited by applicant]
Edelman et al., “Pramlintide in the Treatment of Diabetes Mellitus”, [cited by applicant]
El-Khatib et al., “A Bihormonal Closed-Loop Artificial Pancreas for Type 1 Diabetes”, [cited by applicant]
El-Khatib et al., “Autonomous and Continuous Adaptation of a Bihormonal Bionic Pancreas in Adults and Adolescents With Type 1 Diabetes”, [cited by applicant]
Engelgau et al., “The Evolving Diabetes Burden in the United States”, [cited by applicant]
Ettaro et al., “Cost-of-Illness Studies in Diabetes Mellitus”, [cited by applicant]
Fanelli et al., “Meticulous Prevention of Hypoglycemia Normalizes the Glycemic Thresholds and Magnitude of Most of Neuroendocrine Responses to, Symptoms of, and Cognitive Function During Hypoglycemia in intensively Trea… [cited by applicant]
Fang et al., “Study Reanalysis Using a Mechanism-Based Pharmacokinetic/Pharmacodynamic Model of Pramlintide in Subjects with Type 1 Diabetes”, [cited by applicant]
Farhy et al., “Pancreatic Network Control of Glucagon Secretion and Counterregulation”, [cited by applicant]
Farhy et al., “Models of Glucagon Secretion, Their Application to the Analysis of the Defects in Glucagon Counterregulation and Potential Extension to Approximate Glucagon Action”, [cited by applicant]
Feigh et al., “A novel oral form of salmon calcitonin improves glucose homeostasis and reduces body weight in diet-induced obese rats”, [cited by applicant]
Feigh et al., “Oral salmon calcitonin attenuates hyperglycemia and preserves pancreatic beta-cell area and function in Zucker diabetic fatty acids”, [cited by applicant]
Feigh et al., “Oral Salmon Calcitonin Improves Fasting and Postprandial Glycemic Control in Lean Healthy Rats”, [cited by applicant]
Feigh et al., “Oral salmon calcitonin enhances insulin action and glucose metabolism in diet-induced obese streptozotocin-diabetic rats”, [cited by applicant]
Fernandes-Santos et al., “Amylin Acts in the Central Nervous System to Increase Sympathetic Nerve Activity”, [cited by applicant]
Fidler et al., “Hypoglycemia: An overview of fear of hypoglycemia, quality-of-life, and impact on costs”, [cited by applicant]
Fineman et al., “The Human Amylin Analog, Pramlintide, Corrects Postprandial Hyperglucagonemia in Patients With Type 1 Diabetes”, [cited by applicant]
Flores et al., “Intestinal transport of 3-O-methyl-D-glucose in the normal and alloxan-diabetic rat”, [cited by applicant]
Fu et al., “Amylin receptor: a common pathophysiological target in Alzheimer's disease and diabetes mellitus”, [cited by applicant]
Fukuda et al., “Electrophysiologically identified presynaptic mechanisms underlying amylinergic modulation of area postrema neuronal excitability in rat brain slices”, [cited by applicant]
Gedulin et al., “Dose-Response for Glucagonostatic Effect of Amylin in Rats”, [cited by applicant]
Gedulin et al., “Hypoglycemia Overrides Amylin-Mediated Regulation of Gastric Emptying in Rats”, [cited by applicant]
Greenway et al., “Combination Drugs for Treating Obesity”, [cited by applicant]
Gromada et al., “α-Cells of the Endocrine Pancreas: 35 Years of Research but the Enigma Remains”, [cited by applicant]
Guerreiro et al., “Preparation and Characterization of PEGylated Amylin”, [cited by applicant]
Guidobono et al., “Amylin Given by Central and Peripheral Routes Inhibits Acid Gastric Secretion”, [cited by applicant]
Gydesen et al., “Optimization of tolerability and efficacy of the novel dual amylin and calcitonin receptor agonist KBP-089 through dose escalation and combination with a GLP-1 analog”, [cited by applicant]
Harris et al., “Prevalence of Adult-Onset IDDM in the U.S. Population”, [cited by applicant]
Hassan et al., “Reducing postprandial hyperglycemia with adjuvant premeal pramlintide and postmeal insulin in children with type 1 diabetes mellitus”, [cited by applicant]
Hauber et al., “Risking health to avoid injections; preferences of Canadians with type 2 diabetes”, [cited by applicant]
Hay, “Amylin Receptor” Elsevier Inc. (2007) 14 pages. [cited by applicant]
Hay et al., “Amylin: Pharmacology, Physiology, and Clinical Potential”, [cited by applicant]
Hay et al., “Receptor-Activity Modifying Proteins (RAMPs): New Insights and Roles”, [cited by applicant]
Heptulla et al., “The Role of Amylin and Glucagon in the Dampening of Glycemic Excursions in Children With Type 1 Diabetes”, [cited by applicant]
Heptulla et al., “Gastric emptying and postprandial glucose excursions in adolescents with type 1 diabetes”, [cited by applicant]
Heptulla et al., “Twenty-Four-Hour Simultaneous Subcutaneous Basal-Bolus Administration of Insulin and Amylin in Adolescents with Type 1 Diabetes Decreases Postprandial Hyperglycemia”, [cited by applicant]
Heymsfield et al., “Recombinant Leptin for Weight Loss in Obese and Lean Adults; A Randomized, Controlled, Dose-Escalation Trial”, [cited by applicant]
Hilton et al., “Identification of key components in the irreversibility of salmon calcitonin binding to calcitonin receptors”, [cited by applicant]
Hollander et al., “Pramlintide as an Adjunct to Insulin Therapy Improves Long-Term Glycemic and Weight Control in Patients with Type 2 Diabetes: A 1-year randomized controlled trial”, [cited by applicant]
Hollander et al., “Effect of Pramlintide on Weight in Overweight and Obese Insulin-Treated Type 2 Diabetes Patients”, [cited by applicant]
Hoogwerf et al., “Pramlintide, the synthetic analogue of amylin: physiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk”, [cited by applicant]
Hovorka et al., “Nonlinear model predictive control of glucose concentration in subjects with type 1 diabetes”, [cited by applicant]
Hovorka, “Closed-loop insulin delivery: from bench to clinical practice”, [cited by applicant]
Huffman et al., “Continuous Subcutaneous Pramlintide Infusion Therapy in Patients with Type 1 Diabetes: Observations from a Pilot Study”, [cited by applicant]
International Search Report and Written Opinion for PCT International Patent Application No. PCT/US2019/055696, mailed Jan. 20, 2020, 12 pages. [cited by applicant]
Israelian et al., “Increasing the Decrement in Insulin Secretion Improves Glucagon Responses to Hypoglycemia in Advanced Type 2 Diabetes”, [cited by applicant]
Johnson et al., “Increasing incidence of serious hypoglycemia in insulin users”, [cited by applicant]
Jönsson et al., “Cost of Hypoglycemia in Patients with Type 2 Diabetes in Sweden”, [cited by applicant]
Kang et al., “Preparation, In Vitro Release, In Vivo Absorption and Biocompatibility Studies of Insulin-loaded Microspheres in Rabbits”, [cited by applicant]
Karl et al., “Pramlintide as an Adjunct to Insulin in Patients with Type 2 Diabetes in a Clinical Practice Setting Reduced A1C, Postprandial Glucose Excursions, and Weight”, [cited by applicant]
Karvonen et al., “Incidence of Childhood Type 1 Diabetes Worldwide”, [cited by applicant]
Kawamori et al., “Insulin Signaling in a Cells Modulates Glucagon Secretion In Vivo”, [cited by applicant]
Kimura et al., “Beta Amyloid-Induced Depression of Hippocampal Long-Term Potentiation Is Mediated through the Amylin Receptor”, [cited by applicant]
King, “Comparison of the Post-Meal Glucose Response to Different Insulin Bolus Waveforms in Insulin Pump- and Pre-Meal Pramlintide-Treated Type 1 Diabetes Patients”, [cited by applicant]
Kishiyama et al., “A Pilot Trial of Pramlintide Home Usage in Adolescents With Type 1 Diabetes”, [cited by applicant]
Kodl et al., “Practical Strategies to Normalize Hyperglycemia Without Undue Hypoglycemia in Type 2 Diabetes Mellitus”, [cited by applicant]
Kong et al., “Infusion of pramlintide, a human amylin analogue, delays gastric emptying in men with IDDM”, [cited by applicant]
Kovatchev et al., “Algorithmic Evaluation of Metabolic Control and Risk of Severe Hypoglycemia in Type 1 and Type 2 Diabetes Using Self-Monitoring Blood Glucose Data”, [cited by applicant]
Kovatchev et al., “Quantifying Temporal Glucose Variability in Diabetes via Continuous Glucose Monitoring: Mathematical Methods and Clinical Application”, [cited by applicant]
Kovatchev et al., “Pramlintide Reduces the Risks Associated with Glucose Variability in Type 1 Diabetes”, [cited by applicant]
Kowalczyk et al., “Convergent chemoenzymatic synthesis of a library of glycosylated analogues of pramlintide: structure-activity relationships for amylin receptor agonism”, [cited by applicant]
Kraenzlin et al., “Infusion of a novel peptide, calcitonin gene-related peptide (CGRP) in man. Pharmacokinetics and effects on gastric acid secretion and on gastrointestinal hormones”, [cited by applicant]
Kreymann et al., “Glucagon-Like Peptide-1 7-36: A Physiological Incretin In Man”, [cited by applicant]
Kuwasako et al., “β-arrestins negatively control human adrenomedullin type 1- receptor internalization”, [cited by applicant]
Laporte et al., “Prevalence and Incidence of Insulin-Dependent Diabetes”, [cited by applicant]
Lebovitz, “Adjunct therapy for type 1 diabetes mellitus”, [cited by applicant]
Lebovitz, “Pramlintide: profile of an amylin analog”, [cited by applicant]
Lee et al., “in vivo assessment of salmon calcitonin sustained release from biodegradable microspheres”, [cited by applicant]
Lee et al., “Oral delivery of salmon calcitonin”, [cited by applicant]
Lee et al., “Efficacy and Harms of the Hypoglycemic Agent Pramlintide in Diabetes Mellitus”, [cited by applicant]
Lee et al., “How Type II Diabetes-Related Islet Amyloid Polypeptide Damages Lipid Bilayers”, [cited by applicant]
Leese et al., “Frequency of Severe Hypoglycemia Requiring Emergency Treatment in Type 1 and Type 2 Diabetes; A population-based study of health service resource use”, [cited by applicant]
Leichter, “The Business of Insulin: A Relationship Between Innovation and Economics”, [cited by applicant]
Levetan et al., “Impact of Pramlintide on Glucose Fluctuations and Postprandial Glucose, Glucagon, and Triglyceride Excursions Among Patients With Type 1 Diabetes Intensively Treated With Insulin Pumps”, [cited by applicant]
Levy et al., “Novel Exenatide Analogs with Peptidic Albumin Binding Domains: Potent Anti-Diabetic Agents with Extended Duration of Action”, [cited by applicant]
Liese et al., “The Burden of Diabetes Mellitus Among US Youth: Prevalence Estimates From the SEARCH for Diabetes in Youth Study”, [cited by applicant]
Lillioja et al., “In Vivo Insulin Action Is Familial Characteristic in Nondiabetic Pima Indians”, [cited by applicant]
Ludvik et al., “Inverse relation between amylin and glucagon secretion in healthy and diabetic human subjects”, [cited by applicant]
Mack et al., “Pharmacological actions of the peptide hormone amylin in the long-term regulation of food intake, food preference, and body weight”, [cited by applicant]
Mack et al., “Davalintide (AC2307), a novel amylin-mimetic peptide: enhanced pharmacological properties over native amylin to reduce food intake and body weight”, [cited by applicant]
Mack et al., “Glucoregulatory effects and prolonged duration of action of davalintide: a novel amylinomimetic peptide”, [cited by applicant]
Maggs et al., “Pramlintide reduces postprandial glucose excursions when added to insulin lispro in subjects with type 2 diabetes: a dose-timing study”, [cited by applicant]
Maianti et al., “Anti-diabetic activity of insulin-degrading enzyme inhibitors mediated by multiple hormones”, [cited by applicant]
Makita et al., “Biased agonism: a novel paradigm in G protein-coupled receptor signaling observed in acquired hypocalciuric hypercalcemia”, [cited by applicant]
Marks et al., “Gastric acid secretion in diabetes mellitus”, [cited by applicant]
Marrero et al., “Effect of Adjunctive Pramlintide Treatment on Treatment Satisfaction in Patients With Type 1 Diabetes”, [cited by applicant]
Mccall et al., “A Novel Analytical Method for Assessing Glucose Variability: Using CGMS in Type 1 Diabetes Mellitus”, [cited by applicant]
Mccrimmon et al., “Hypoglycemia in Type 1 Diabetes”, [cited by applicant]
Mehta, “Clinical Development Case Study: Optimizing a Solid Dosage Formulation for the Oral Delivery of Peptides”, TIDES, Boston (May 25, 2011). [cited by applicant]
Mehta et al., “Preclinical Studies with UGP281, a Potent, Orally Delivered, Anorexigenic Peptide”, Unigene ADA Poster 2011. [cited by applicant]
Micheletto et al., “In Silico Design of Optimal Ratio for Co-Administration of Pramlintide and Insulin in Type 1 Diabetes”, [cited by applicant]
Miller et al., “Current State of Type 1 Diabetes Treatment in the U.S.: Updated Data From the T1D Exchange Clinic Registry”, [cited by applicant]
Miyazaki et al., “Estimation of Bioavailability of Salmon Calcitonin from the Hypocalcemic Effects in Rats (I): Pharmacokinetic-Pharmacodynamic Modeling Based on the Endogenous Ca Regulatory System”, [cited by applicant]
Miyazaki et al., “Estimation of Bioavailability of Salmon Calcitonin from the Hypocalcemic Effect in Rats (II): Effect of Protease Inhibitor on the Pharmacokinetic-Pharmacodynamic Relationship after Intranasal Administr… [cited by applicant]
Morfis et al., “Receptor Activity-Modifying Proteins Differentially Modulate the G Protein-Coupling Efficiency of Amylin Receptors”, [cited by applicant]
Nordfeldt et al., “Short-term effects of severe hypoglycaemia in children and adolescents with type 1 diabetes. A cost-of-illness study”, [cited by applicant]
Notkins et al., “Autoimmune type 1 diabetes: resolved and unresolved issues”, [cited by applicant]
Nyholm et al., “The Amylin Analog Pramlintide Improves Glycemic Control and Reduces Postprandial Glucagon Concentrations in Patients With Type 1 Diabetes Mellitus”, [cited by applicant]
Onkamo et al., “Worldwide increase in incidence of Type I diabetes—the analysis of the data on published incidence trends”, [cited by applicant]
Osuga et al., “Derivation of Functional Antagonists Using N-Terminal Extracellular Domain of Gonadotropin and Thyrotropin Receptors”, [cited by applicant]
Overman et al., “Salmon Calcitonin Use and Associated Cancer Risk”, [cited by applicant]
Palerm, “Physiologic insulin delivery with insulin feedback: A control systems perspective”, [cited by applicant]
Palmer et al., “The CORE Diabetes Model: Projecting Long-term Clinical Outcomes, Costs and Cost-effectiveness of Interventions in Diabetes Mellitus (Types 1 and 2) to Support Clinical and Reimbursement Decision-making”, [cited by applicant]
Pambianco et al., “The 30-Year Natural History of Type 1 Diabetes Complications; The Pittsburgh Epidemiology of Diabetes Complications Study Experience”, [cited by applicant]
Pawaskar et al., “Medication utilization patterns among type 2 diabetes patients initiating Exenatide BID or insulin glargine: a retrospective database study”, [cited by applicant]
Pencek et al., “Safety of pramlintide added to mealtime insulin in patients with type 1 or type 2 diabetes: a large observational study”, [cited by applicant]
Peyser et al., “The artificial pancreas: current status and future prospects in the management of diabetes”, [cited by applicant]
Pickup et al., “Severe hypoglycaemia and glycaemic control in Type 1 diabetes: meta-analysis of multiple daily insulin injections compared with continuous subcutaneous insulin infusion”, [cited by applicant]
Pittner et al., “Molecular Physiology of Amylin”, [cited by applicant]
Portuese et al., “Mortality in Insulin-Dependent Diabetes”, [cited by applicant]
Potes et al., “Brainstem mechanisms of amylin-induced anorexia”, [cited by applicant]
Potter et al., “Islet amyloid deposition limits the viability of human islet grafts but not porcine islet grafts”, [cited by applicant]
Pullman et al., “Pramlintide in the management of insulin-using patients with type 2 and type 1 diabetes”, [cited by applicant]
Purnell et al., “Patient Preferences for Noninsulin Diabetes Medications: A Systematic Review”, [cited by applicant]
Raman et al., “The Role of Adjunctive Exenatide Therapy in Pediatric Type 1 Diabetes”, [cited by applicant]
Ramkissoon et al., “A Model of Glucose-Insulin-Pramlintide Pharmacokinetics and Pharmacodynamics in Type I Diabetes”, [cited by applicant]
Ratner et al., “Adjunctive Therapy with Pramlintide Lowers HbA1c without Concomitant Weight Gain and Increased Risk of Severe Hypoglycemia in Patients with Type 1 Diabetes Approaching Glycemic Targets”, [cited by applicant]
Ravussin et al., “Enhanced Weight Loss With Pramlintide/Metreleptin: An Integrated Neurohormonal Approach to Obesity Pharmacotherapy”, [cited by applicant]
Rhoads et al., “Contribution of Hypoglycemia to Medical Care Expenditures and Short-Term Disability in Employees With Diabetes”, [cited by applicant]
Riddle et al., “Pramlintide Improved Glycemic Control and Reduced Weight in Patients With Type 2 Diabetes Using Basal Insulin”, [cited by applicant]
Riddle et al., “Control of Postprandial Hyperglycemia in Type 1 Diabetes by 24-Hour Fixed-Dose Coadministration of Pramlintide and Regular Human Insulin: A Randomized, Two-Way Crossover Study”, [cited by applicant]
Riediger et al., “Actions of amylin on subfornical organ neurons and on drinking behavior in rats”, [cited by applicant]
Roberson, “The Islet Amyloid Polypeptide hormone Amylin: Its function, effects and uses in medicine”, Loyola Marymount University (Nov. 5, 2012). [cited by applicant]
Rodriguez et al., “The Role of Prandial Pramlintide in the Treatment of Adolescents With Type 1 Diabetes”, [cited by applicant]
Rosenstock et al., “Effects of Exenatide and Lifestyle Modification on Body Weight and Glucose Tolerance in Obese Subjects With and Without Pre-Diabetes”, [cited by applicant]
Roth, “Amylin and the regulation of appetite and adiposity: recent advances in receptor signaling, neurobiology and pharmacology”, [cited by applicant]
Roth et al., “Antiobesity Effects of the β-Cell Hormone Amylin in Diet-Induced Obese Rats: Effects on Food Intake, Body Weight, Composition, Energy Expenditure, and Gene Expression”, [cited by applicant]
Roth et al., “Leptin responsiveness restored by amylin agonism in diet-induced obesity: Evidence from nonclinical and clinical studies”, [cited by applicant]
Roth et al., “Antiobesity effects of the β-cell hormone amylin in combination with phentermine or sibutramine in diet-induced obese rats”, [cited by applicant]
Roth et al., “‘Weighing in’ on synergy: Preclinical research on neurohormonal anti-obesity combinations”, [cited by applicant]
Roth et al., “GLP-1R and amylin agonism in metabolic disease: complementary mechanisms and future opportunities”, [cited by applicant]
Routledge et al., “The effects of RAMPs upon cell signalling”, [cited by applicant]
Ruiz et al., “Effect of Insulin Feedback on Closed-Loop Glucose Control: A Crossover Study”, [cited by applicant]
Russell et al., “Blood Glucose Control in Type 1 Diabetes With a Bihormonal Bionic Endocrine Pancreas”, [cited by applicant]
Russell-Jones et al., “Efficacy and Safety of Exenatide Once Weekly Versus Metformin, Pioglitazone, and Sitagliptin Used as Monotherapy in Drug-Naive Patients With Type 2 Diabetes (DURATION-4)”, [cited by applicant]
Ryan et al., “Review of pramlintide as adjunctive therapy in treatment of type 1 and type 2 diabetes”, [cited by applicant]
Schmitz et al., “Effects of Amylin and the Amylin Agonist Pramlintide on Glucose Metabolism”, [cited by applicant]
Schorr et al., “Simultaneous Use of Two External Subcutaneous Pumps Delivering Insulin and SYMLIN: Use of a Double-Pump System”, [cited by applicant]
Schvarcz et al., “Physiological Hyperglycemia Slows Gastric Emptying in Normal Subjects and Patients With Insulin-Dependent Diabetes Mellitus”, [cited by applicant]
Schwartz et al., “Glycemic Control and Weight Reduction Without Causing Hypoglycemia: The Case for Continued Safe Aggressive Care of Patients With Type 2 Diabetes Mellitus and Avoidance of Therapeutic Inertia”, [cited by applicant]
Seth et al., “Combined amylin-leptin treatment lowers blood pressure and adiposity in lean and obese rats”, [cited by applicant]
Sexton et al., “Modulating receptor function through RAMPs: can they represent drug targets in themselves?”, [cited by applicant]
Shaw et al., “Global estimates of the prevalence of diabetes for 2010 and 2030”, [cited by applicant]
Sherr et al., “Reduced Hypoglycemia and Increased Time in Target Using Closed-Loop Insulin Delivery During Nights With or Without Antecedent Afternoon Exercise in Type 1 Diabetes”, [cited by applicant]
Sherr et al., “Evolution of Abnormal Plasma Glucagon Responses to Mixed-Meal Feedings in Youth With Type 1 Diabetes During the First 2 Years After Diagnosis”, [cited by applicant]
Sherr et al., “Evolution of Abnormal Plasma Glucagon Responses to Mixed-Meal Feedings in Youth With Type 1 Diabetes During the First 2 Years After Diagnosis—Supplemental Data”, [cited by applicant]
Silverstein et al., “Care of Children and Adolescents With Type 1 Diabetes—A statement of the American Diabetes Association”, [cited by applicant]
Silvestre et al., “Influence of glucose concentration on the inhibitory effect of amylin on insulin secretion. Study in the perfused rat pancreas”, [cited by applicant]
Silvestre et al., “Selective amylin inhibition of the glucagon response to arginine is extrinsic to the pancreas”, [cited by applicant]
Smith et al., “Pramlintide treatment reduces 24-h caloric intake and meal sizes and improves control of eating in obese subjects: a 6-wk translational research study”, [cited by applicant]
Smith et al., “Sustained Weight Loss Following 12-Month Pramlintide Treatment as an Adjunct to Lifestyle Intervention in Obesity”, [cited by applicant]
Smith et al., “Sustained Weight Loss Following 12-Month Pramlintide Treatment as an Adjunct to Lifestyle Intervention in Obesity—Supplemental Information”, [cited by applicant]
Soedamah-Muthu et al., “Predicting major outcomes in type 1 diabetes: a model development and validation study”, [cited by applicant]
Steil et al., “Modeling β-Cell Insulin Secretion-Implications for Closed-Loop Glucose Homeostasis”, [cited by applicant]
Steil et al., “The Effect of Insulin Feedback on Closed Loop Glucose Control”, [cited by applicant]
Sun et al., “Bifunctional PEGylated Exenatide-Amylinomimetic Hybrids to Treat Metabolic Disorders: An Example of Long-Acting Dual Hormonal Therapeutics”, [cited by applicant]
Sun et al., “Calcitonin Nasal Spray and Increased Cancer Risk: A Population-Based Nested Case-Control Study”, [cited by applicant]
Taborsky, JR. et al., “Autonomic Mediation of Glucagon Secretion During Hypoglycemia—Implications for Impaired α-Cell Responses in Type 1 Diabetes”, [cited by applicant]
Thompson et al., “Pramlintide: A Human Amylin Analogue Reduced Postprandial Plasma Glucose, Insulin, and C-peptide Concentrations in Patients with Type 2 Diabetes”, [cited by applicant]
Thorogood et al., “The Effects of Pancreatectomy on Glycosuria and Ketosis in Dogs made Diabetic by Alloxan”, [cited by applicant]
Trevaskis et al., “Amylin-Mediated Restoration of Leptin Responsiveness in Diet-Induced Obesity: Magnitude and Mechanisms”, [cited by applicant]
Trevaskis et al., “Interaction of Leptin and Amylin in the Long-term Maintenance of Weight Loss in Diet-induced Obese Rats”, [cited by applicant]
Trevaskis et al., “Insights into amylin-leptin synergy”, [cited by applicant]
Trevaskis et al., “Improved Glucose Control and Reduced Body Weight in Rodents with Dual Mechanism of Action Peptide Hybrids”, [cited by applicant]
Tucker, “Liraglutide Benefits Patients With Type 1 Diabetes”, [cited by applicant]
Uhing et al., “Active Transport of 3-O-Methyl-Glucose by the Small Intestine in Chronically Catheterized Rats”, [cited by applicant]
Unger et al., “Recognition, Prevention, and Proactive Management of Hypoglycemia in Patients with Type I Diabetes Mellitus”, [cited by applicant]
Unger et al., “Glucagonocentric restructuring of diabetes: a pathophysiologic and therapeutic makeover”, [cited by applicant]
Van Witteloostujin et al., “Neoglycolipids for Prolonging the Effects of Peptides: Self-Assembling Glucagon-like Peptide 1 Analogues with Albumin Binding Properties and Potent in Vivo Efficacy”, [cited by applicant]
Van Witteloostujin et al., “Neoglycolipids for Prolonging the Effects of Peptides: Self-Assembling Glucagon-like Peptide 1 Analogues with Albumin Binding Properties and Potent in Vivo Efficacy—Supplemental Data”, [cited by applicant]
Vine et al., “Comparison of the in vitro and in vivo pharmacology of adrenomedullin, calcitonin gene-related peptide and amylin in rats”, [cited by applicant]
Vine et al., “Effects of Rat Amylin on Renal Function in the Rat”, [cited by applicant]
Wagner, “Pharmacokinetic Absorption Plots from Oral Data Alone or Oral/Intravenous Data and An Exact Loo-Riegelman Equation”, [cited by applicant]
Walker, “Use of continuous glucose monitoring to introduce adjunctive pramlintide therapy in a patient with type 1 diabetes: A case study”, [cited by applicant]
Walker et al., “Mice Lacking the Neuropeptide α-Calcitonin Gene-Related Peptide Are Protected Against Diet-Induced Obesity”, [cited by applicant]
Watson et al., “The Use of Stimulus-Biased Assay Systems to Detect Agonist- Specific Receptor Active States: Implications for the Trafficking of Receptor Stimulus by Agonists”, [cited by applicant]
Weinzimer et al., “Fully Automated Closed-Loop Insulin Delivery Versus Semiautomated Hybrid Control in Pediatric Patients with Type 1 Diabetes Using an Artificial Pancreas”, [cited by applicant]
Weinzimer et al., “Effect of Pramlintide on Prandial Glycemic Excursions During Closed-Loop Control in Adolescents and Young Adults With Type 1 Diabetes”, [cited by applicant]
Werle et al., “Strategies to improve plasma half life time of peptide and protein drugs”, [cited by applicant]
Weyer et al., “Amylin Replacement With Pramlintide as an Adjunct to Insulin Therapy in Type 1 and Type 2 Diabetes Mellitus: A Physiological Approach Toward Improved Metabolic Control”, [cited by applicant]
Weyer et al., “Properties of pramlintide and insulin upon mixing”, [cited by applicant]
Whitehouse et al., “A Randomized Study and Open-Label Extension Evaluating the Long-Term Efficacy of Pramlintide as an Adjunct to Insulin Therapy in Type 1 Diabetes”, [cited by applicant]
Wild et al., “Global Prevalence of Diabetes—Estimates for the year 2000 and projections for 2030”, [cited by applicant]
Wilinska et al., “Insulin Kinetics in Type-1 Diabetes: Continuous and Bolus Delivery of Rapid Acting Insulin”, [cited by applicant]
Withycombe, “A 4-month Randomized Controlled Clinical Trial of Adjuvant Exenatide or Pramlintide Versus Insulin Alone in Pediatric Type 1 Diabetes Mellitus: Effect on Glycemic Control”, The University of Texas Medical B… [cited by applicant]
Wood et al., “Incretins and amylin in pediatric diabetes: new tools for management of diabetes in youth”, [cited by applicant]
Woods et al., “Pancreatic signals controlling food intake; insulin, glucagon and amylin”, [cited by applicant]
Woolley et al., “Receptor activity-modifying protein dependent and independent activation mechanisms in the coupling of calcitonin gene-related peptide and adrenomedullin receptors to Gs”, [cited by applicant]
Xu et al., “Prevalence of diagnosed type 1 and type 2 diabetes among US adults in 2016 and 2017: population based study”, [cited by applicant]
Yki-Jarvinen et al., “Regulation of Glycogen Synthase and Phosphorylase Activities by Glucose and Insulin in Human Skeletal Muscle”, [cited by applicant]
Young, “Brainstem sensing of meal-related signals in energy homeostasis”, [cited by applicant]
Young et al., “Insulin response of components of whole-body and muscle carbohydrate metabolism in humans”, [cited by applicant]
Young et al., “Muscle Glycogen Synthesis and Disposition of Infused Glucose in Humans With Reduced Rates of Insulin-Mediated Carbohydrate Storage”, [cited by applicant]
Young et al., “Amylin activates glycogen phosphorylase in the isolated soleus muscle of the rat”, [cited by applicant]
Young et al., “Amylin and insulin in rat soleus muscle: dose responses for cosecreted noncompetitive antagonists”, [cited by applicant]
Young et al., “Dose Response Characteristics for the Hyperglycemic, Hyperlactemic, Hypotensive and Hypocalcemic Actions of Amylin and Calcitonin Gene-Related Peptide-I (CGRPα) in the Fasted, Anaesthetized Rat”, [cited by applicant]
Young et al., “Amylin and Syndrome-X”, [cited by applicant]
Young et al., “Amylin regulation of carbohydrate metabolism”, [cited by applicant]
Young et al., “Gastric emptying is accelerated in diabetic BB rats and is slowed by subcutaneous injections of amylin”, [cited by applicant]
Young et al., “Diabetogenic Effects of Salmon Calcitonin Are Attributable to Amylin-Like Activity”, [cited by applicant]
Young et al., “Dose-Responses for the Slowing of Gastric Emptying in a Rodent Model by Glucagon-Like Peptide (7-36)NH [cited by applicant]
Young et al., “Preclinical Pharmacology of Pramlintide in the Rat: Comparisons With Human and Rat Amylin”, [cited by applicant]
Young et al., “Dose-response for inhibition by amylin of cholecystokinin-stimulated secretion of amylase and lipase in rats”, [cited by applicant]
Younk et al., “Pramlintide and the treatment of diabetes: a review of the data since its introduction”, [cited by applicant]
Zelissen et al., “Effect of three treatment schedules of recombinant methionyl human leptin on body weight in obese adults: a randomized, placebo-controlled trial”, [cited by applicant]
Zhang et al., “The Burden of Hypoglycemia in Type 2 diabetes: A Systematic Review of Patient and Economic Perspectives”, [cited by applicant]
Zhang et al., “Porcine islet amyloid polypeptide fragments are refractory to amyloid formation”, [cited by applicant]
Zhou et al., “Understanding the GPCR biased signaling through G protein and arrestin complex structures”, [cited by applicant]
U.S. Appl. No. 16/598,915 / 2020-0115430 A1, filed Oct. 10, 2019 / Apr. 16, 2020, William Blackwell. [cited by applicant]