c-MET kinase binding proteins
Polypeptides comprising monomer domains that bind to c-MET, or portions thereof, are provided.
1. An isolated polypeptide comprising at least one monomer domain that binds to c-MET, wherein the at least one monomer domain comprises a sequence selected from the group consisting of (i) SEQ ID NO:8, (ii) SEQ ID NO:13, (iii) at least amino acids 1-34 of SEQ ID NO:15 and (iv) a sequence that is at least 95% identical to a sequence defined by any of (i), (ii) or (iii), as defined herein:
Cxxx[EQ]FxCxSTxRC[IV]xxxWxCDGDNDCEDxSDEx (SEQ ID NO:8),
wherein the first x is an amino acid chosen from A, L, E, R, P, and Q,
the second x is an amino acid chosen from P, A, and S,
the third x is an amino acid chosen from S, N, and G,
the fourth x is an amino acid chosen from T, Q, and K,
the fifth x is an amino acid chosen from N, R, S, and H,
the sixth x is an amino acid chosen from G, N, D, and E,
the seventh x is an amino acid chosen from P and S,
the eighth x is an amino acid chosen from Q, L, and A,
the ninth x is an amino acid chosen from E, T, Q, A, S, G, and D
the tenth x is an amino acid chosen from V and L,
the eleventh x is an amino acid chosen from S and G,
the twelfth x is an amino acid chosen from A, S, and K, and
amino acids in brackets are alternative amino acids at a single position;
Cxxx[EQ]FxCxSTGRCxPxxWxCxGxNDCEDxSDEx (SEQ ID NO:13),
wherein the first x is an amino acid chosen from A, E, V, R, L, P, and Q,
the second x is an amino acid chosen from A, S, P, T, and L,
the third x is an amino acid chosen from D, S, N, and G,
the fourth x is an amino acid chosen from Q, T, and R,
the fifth x is an amino acid chosen from N, H, and R,
the sixth x is any amino acid,
the seventh x is an amino acid chosen from V, Q, L, R, A, and G,
the eighth x is an amino acid chosen from S, E, D, Q, and A,
the ninth x is any amino acid,
the tenth x is amino acid chosen from D and H,
the eleventh amino acid is V and D,
the twelfth x is an amino acid chosen from S and G,
the thirteenth x is an amino acid chosen from A, T, S, and E,
and amino acids in brackets are alternative amino acids at a single position; and
at least amino acids 1-34 of
Cxxx[EQ]FxCxxxxxC[ILV]xxxWxCDGxNDCxDxSxExxxxC (SEQ ID NO:15),
wherein the first x is an amino acid chosen from P, Q, V, L, and E,
the second x is an amino acid chosen from A, S, and P,
the third x is an amino acid chosen from G, S, N, and D,
the fourth x is an amino acid chosen from Q, R, T, and M,
the fifth x is any amino acid,
the sixth x is any amino acid,
the seventh x is an amino acid chosen from T, G, and N,
the eighth x is any amino acid,
the ninth x is an amino acid chosen from R and Q,
the tenth x is amino acid chosen from P and S,
the eleventh amino acid is any amino acid,
the twelfth x is an amino acid chosen from T, P, N, D, A, and H,
the thirteenth x is an amino acid chosen from L, G, and V,
the fourteenth x is an amino acid chosen from D, V, and E,
the fifteenth x is an amino acid chosen from E and G,
the sixteenth x is an amino acid chosen from G and S,
the seventeenth x is any amino acid,
the eighteenth x is any amino acid,
the nineteenth x is any amino acid,
the twentieth x is any amino acid,
the twenty first x is any amino acid,
and amino acids in brackets are alternative amino acids at a single position.
2. The polypeptide of claim 1 comprising at least two monomer domains that bind to c-MET wherein each of the at least two monomer domains comprises a sequence selected from the group consisting of SEQ ID NO:8, a sequence that is at least 95% identical to SEQ ID NO:8, SEQ ID NO:13, a sequence that is at least 95% identical to SEQ ID NO:13, at least amino acids 1-34 of SEQ ID NO:15, and a sequence that is at least 95% identical to at least amino acids 1-34 of SEQ ID NO:15, as defined in claim 1 .
3. The polypeptide of claim 1 comprising at least three monomer domains that bind to c-MET wherein each of the monomer domains comprises a sequence selected from the group consisting of SEQ ID NO:8, a sequence that is at least 95% identical to SEQ ID NO:8, SEQ ID NO:13, a sequence that is at least 95% identical to SEQ ID NO:13, at least amino acids 1-34 of SEQ ID NO:15, and a sequence that is at least 95% identical to at least amino acids 1-34 of SEQ ID NO:15, as defined in claim 1 .
4. The polypeptide of claim 1 wherein at least one monomer domain comprises at least amino acids 1-38 of the following sequence:
CQPNEFQCHSTGRCIPASWLCDGDNDCEDSSDESPANCATPTHT (SEQ ID NO:641).
5. An isolated polypeptide comprising at least three monomer domains that bind to c-MET, wherein
one monomer domain comprises a sequence selected from the group consisting of
(1) Cxxx[EQ]FxCxSTGRCxPxxWxCxGxNDCEDxSDEx (SEQ ID NO:13),
wherein the first x is an amino acid chosen from A, E, V, R, L, F, and Q,
the second x is an amino acid chosen from A, S, P, T, and L,
the third x is an amino acid chosen from D, S, N, and G,
the fourth x is an amino acid chosen from Q, T, and R,
the fifth x is an amino acid chosen from N, H, and R,
the sixth x is any amino acid,
the seventh x is an amino acid chosen from V, Q, L, R, A, and G,
the eighth x is an amino acid chosen from S, E, D, Q, and A,
the ninth x is any amino acid,
the tenth x is amino acid chosen from D and H,
the eleventh amino acid is V and D,
the twelfth x is an amino acid chosen from S and G,
the thirteenth x is an amino acid chosen from A, T, S, and E,
and amino acids in brackets are alternative amino acids at a single position, and
(ii) a sequence that is at least 95% identical to a sequence defined by (i);
another monomer domain comprises a sequence selected from the group consisting of
(iii) at least amino acids 1-34 of:
Cxxx[EQ]FxCxxxxxC[ILV]xxxWxCDGxNDCxDxSxExxxxC (SEQ ID NO:15),
wherein the first x is an amino acid chosen from P, Q, V, L, and E,
the second x is an amino acid chosen from A, S, and P,
the third x is an amino acid chosen from G, S, N, and D,
the fourth x is an amino acid chosen from Q, R, T, and M,
the fifth x is an amino acid chosen from any amino acid,
the sixth x is any amino acid,
the seventh x is an amino acid chosen from T, G, and N,
the eight x is any amino acid,
the ninth x is an amino acid chosen from R and Q,
the tenth x is amino acid chosen from P and S,
the eleventh amino acid is any amino acid,
the twelfth x is an amino acid chosen from T, P, N, D, A, and H,
the thirteenth x is an amino acid chosen from L, G, and V,
the fourteenth x is an amino acid chosen from D, V, and E,
the fifteenth x is an amino acid chosen from E and G,
the sixteenth x is an amino acid chosen from G and S,
the seventeenth x is any amino acid,
The eighteenth x is any amino acid,
the nineteenth x is any amino acid,
the twentieth x is any amino acid,
the twenty first x is any amino acid,
and amino acids in brackets are alternative amino acids at a single position, and
(iv) a sequence that is at least 95% identical to a sequence defined by (iii); and
yet another monomer domain comprises a sequence selected from the group consisting of
(v) at least amino acids 1-34 of:
Cxxx[EQ]FxCxxxxxC[ILV]xxxWxCDGxNDCxDxSxExxxxC (SEQ ID NO:15),
wherein the first x is an amino acid chosen from P, Q, V, L, and E,
the second x is an amino acid chosen from A, S, and P,
the third x is an amino acid chosen from G, S, N, and D,
the fourth x is an amino acid chosen from Q, R, T, and M,
the fifth x is an amino acid chosen from any amino acid,
the sixth x is any amino acid,
the seventh x is an amino acid chosen from T, G, and N,
the eighth x is any amino acid,
the ninth x is an amino acid chosen from R and Q,
the tenth x is amino acid chosen from P and S,
the eleventh amino acid is any amino acid,
the twelfth x is an amino acid chosen from T, P, N, D, A, and H,
the thirteenth x is an amino acid chosen from L, G, and V,
the fourteenth x is an amino acid chosen from D, V, and E,
the fifteenth x is an amino acid chosen from E and G,
the sixteenth x is an amino acid chosen from G and S,
the seventeenth x is any amino acid,
the eighteenth x is any amino acid,
the nineteenth x is any amino acid,
the twentieth x is any amino acid,
the twenty first x is any amino acid,
and amino acids in brackets are alternative amino acids at a single position; and
(vi) a sequence that is at least 95% identical to a sequence defined by (v).
6. An isolated polypeptide comprising at least three monomer domains that bind to c-MET, wherein
one monomer domain comprises at least amino acids 1-38 of:
CQPNEFQCHSTGRCIPASWLCDGDNDCEDSSDESPANCATPTHT (SEQ ID NO:641);
another monomer domain comprises a sequence selected from the group consisting of
(i) at least amino acids 1-34 of:
Cxxx[EQ]FxCxxxxxC[ILV]xxxWxCDGxNDCxDxSxExxxC (SEQ ID NO:15),
wherein the first x is an amino acid chosen from P, Q, V, L, and E,
the second x is an amino acid chosen from A, S, and P,
the third x is an amino acid chosen from G, S, N, and D,
the fourth x is an amino acid chosen from Q, R, T, and M,
the fifth x is an amino acid chosen from any amino acid,
the sixth x is any amino acid,
the seventh x is an amino acid chosen from T, G, and N,
the eighth x is any amino acid,
the ninth x is an amino acid chosen from R and Q,
the tenth x is amino acid chosen from P and S,
the eleventh amino acid is any amino acid,
the twelfth x is an amino acid chosen from T, P, N, D, A, and H,
the thirteenth x is an amino acid chosen from L, G, and V,
the fourteenth x is an amino acid chosen from D, V, and E,
the fifteenth x is an amino acid chosen from E and G,
the sixteenth x is an amino acid chosen from G and S,
the seventeenth x is any amino acid,
the eighteenth x is any amino acid,
the nineteenth x is any amino acid,
the twentieth x is any amino acid,
the twenty first x is any amino acid,
and amino acids in brackets are alternative amino acids at a single position, and
(ii) a sequence that is at least 95% identical to a sequence defined by (i); and
yet another monomer domain comprises a sequence selected from the group consisting of
(iii) at least amino acids 1-34 of:
Cxxx[EQ]FxCxxxxxC[ILV]xxxWxCDGxNDCxDxSxExxxxC (SEQ ID NO:15),
wherein the first x is an amino acid chosen from P, Q, V, L, and E,
the second x is an amino acid chosen from A, S, and P,
the third x is an amino acid chosen from G, S, N, and D,
the fourth x is an amino acid chosen from Q, R, T, and M,
the fifth x is an amino acid chosen from any amino acid,
the sixth x is any amino acid,
the seventh x is an amino acid chosen from T, G, and N,
the eighth x is any amino acid,
the ninth x is an amino acid chosen from R and Q,
the tenth x is amino acid chosen from P and S,
the eleventh amino acid is any amino acid,
the twelfth x is an amino acid chosen from T, P, N, D, A, and H,
the thirteenth x is an amino acid chosen from L, G, and V,
the fourteenth x is an amino acid chosen from D, V, and E,
the fifteenth x is an amino acid chosen from E and G,
the sixteenth x is an amino acid chosen from G and S,
the seventeenth x is any amino acid,
the eighteenth x is any amino acid,
the nineteenth x is any amino acid,
the twentieth x is any amino acid,
the twenty first x is any amino acid,
and amino acids in brackets are alternative amino acids at a single position; and
(iv) a sequence that is at least 95% identical to a sequence defined by (iii).
7. A polynucleotide encoding the polypeptide of claim 1 .
8. A polynucleotide encoding the polypeptide of claim 2 .
9. A polynucleotide encoding the polypeptide of claim 3 .
10. A polynucleotide encoding the polypeptide of claim 5 .
11. A polynucleotide encoding the polypeptide of claim 6 .
12. The polypeptide of claim 2 wherein at least one monomer domain comprises at least amino acids 1-38 of the following sequence:
CQPNEFQCHSTGRCIPASWLCDGDNDCEDSSDESPANCATPTHT (SEQ ID NO:641).
13. The polypeptide of claim 3 wherein at least one monomer domain comprises at least amino acids 1-38 of the following sequence:
CQPNEFQCHSTGRCIPASWLCDGDNDCEDSSDESPANCATPTHT (SEQ ID NO:641).
14. A polynucleotide encoding the polypeptide of claim 12 .
15. A polynucleotide encoding the polypeptide of claim 13 .
16. The polypeptide of any of claims 1 - 6 , 12 or 13 , further comprising a monomer domain having a binding specificity for a blood factor, thereby increasing the serum half-life of the polypeptide when the polypeptide is injected into an animal compared to the serum half-life of a polypeptide lacking the blood factor-binding monomer domain.
17. The polypeptide of claim 16 , wherein the blood factor is selected from the group consisting of serum albumin, an immunoglobulin and an erythrocyte.
18. The polypeptide of claim 17 , wherein the monomer domain having a binding specificity for a blood factor comprises a sequence selected from the group consisting of:
CHPTGQFRCRSSGRCVSPTWVCDGDNDCGDNSDEENCSAPASEPPGSL (SEQ ID NO:6), and
CHPTGQFRCRSSGRCVSPTWVCDGDNDCGDNSDEENC (SEQ ID NO:7).
19. The polypeptide of any of claims 1 - 6 , 12 or 13 , wherein the polypeptide hither polyethylene glycol (PEG).