IP Library Granted Patent US 7,888,474
Granted Patent B2
US 7,888,474 · App. 12/723,184 · Granted Feb 15, 2011

HDM2 polypeptides

Assignee: Schering Corporation
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 7,888,474
App. No.
12/723,184
Granted
Feb 15, 2011
Kind
B2
Abstract

The present invention relates to HDM2 polypeptides and mutants thereof which are complexed with various compounds, e.g., HDM2 inhibitors.

Claims (24)

1. A complex comprising an isolated polypeptide comprising:

(i) amino acids 17-125 of human HDM2 as set forth in SEQ ID NO: 1;

(ii) amino acids 17-125 of human HDM2 as set forth in SEQ ID NO: 1 comprising an F55Y mutation;

(iii) amino acids 17-125 of human HDM2 as set forth in SEQ ID NO: 1 comprising a Y76H mutation; or

(iv) amino acids 17-125 of human HDM2 as set forth in SEQ ID NO: 1 comprising an F55Y/Y76H double mutation; complexed with a compound

2. The complex of claim 1 wherein said HDM2 amino acids 17-125 are:

(SEQ ID NO: 2)

SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLYYLGQYIMTK

RLYDEKQQHIVHCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV

VNQQESSDSGTSVSEN.

3. A method for making the complex of claim 1 comprising contacting said polypeptide and said compound.

4. A composition comprising ammonium sulfate and a complex of claim 1 comprising:

(a) amino acids 17-125 of human HDM2 as set forth in SEQ ID NO: 1;

(b) amino acids 17-125 of human HDM2 as set forth in SEQ ID NO: 1 comprising an F55Y mutation;

(c) amino acids 17-125 of human HDM2 as set forth in SEQ ID NO: 1 comprising a Y76H mutation; or

(d) amino acids 17-125 of human HDM2 as set forth in SEQ ID NO: 1 comprising an F55Y/Y76H double mutation; complexed with a compound

5. The composition of claim 4 wherein said HDM2 amino acids 17-125 are:

(SEQ ID NO: 2)

SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLYYLGQYIMTKR

LYDEKQQHIVHCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE

SSDSGTSVSEN.

6. The composition of claim 4 wherein the polypeptide is present at a concentration of at least 10 mg/ml.

7. The composition of claim 4 comprising a temperature of about 22° C. or about 4° C.

8. The composition of claim 4 wherein the ammonium sulfate is at a concentration of about 0.9 M.

Assignments (1)
CHANGE OF NAME Recorded Aug 30, 2012
From: SCHERING CORPORATION
To: MERCK SHARP & DOHME CORP.
Reel/Frame 028884/0151 →
Continuity (3)
Division 12249314 · Oct 10, 2008
Provisional Application 60979575 · Oct 12, 2007
Related Publication 20100267150A1 · Oct 21, 2010