Neuromedin and FN-38 peptides for treating psychiatric diseases
Methods and compositions for treating psychiatric diseases and disorders are disclosed. The methods provided generally involve the administration of an NMX peptide, an FNX peptide, or an NMX receptor agonist, or analogs or derivatives thereof, to a subject in order to treat psychiatric diseases and disorders, and conditions associated with psychiatric diseases and disorders.
1. A method for treating schizophrenia in a human in need thereof comprising administering to the human a therapeutically effective amount of a peptide comprising the amino acid sequence of
(SEQ ID NO: 5)
FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN-NH 2
to treat the schizophrenia.
2. The method of claim 1 , further comprising administering to the human a therapeutically effective amount of a second generation antipsychotic.
3. A method for treating schizophrenia in a human in need thereof comprising administering to the human a therapeutically effective amount of a peptide that has at least 90% sequence identity to the peptide comprising the amino acid sequence of
(SEQ ID NO: 5)
FLFHYSKTQKLGKSNVVEELQSPFASQSRGYFLFRPRN-NH 2
to treat the schizophrenia.
4. The method of claim 3 , further comprising administering to the human a therapeutically effective amount of a second generation antipsychotic.