Anticarcinoma antibodies and uses thereof
View Patent ↗A novel single domain antibody AFAI and fragments thereof which has specific affinity for binding to carcinoma, and especially lung carcinoma. This antibody, and portions thereof, can be used, inter alia in the diagnosis and treatment of carcinoma.
1. An isolated single V H domain antibody comprising complementarily determining region (CDR) 1 sequence KNLMG SEQ ID NO.4, CDR2 sequence TISGSGGTNYASSVEG SEQ ID NO.6, and CDR3 sequence AFAI SEQ ID NO.3, and wherein the isolated single domain antibody binds to non-small cell lung carcinoma.
2. A conjugate comprising the isolated single V H domain antibody of claim 1 and a cargo substance.
3. A kit comprising:
the conjugate of claim 2 ; and
instructions for use of the conjugate.
4. An oligomer comprising the isolated single V H domain antibody of claim 1 .
5. The oligomer of claim 4 wherein subunits are linked using at least one of: a peptide linker, a self assembly molecule oligomerization domain, and chemical coupling.
6. The oligomer of claim 4 comprising at least two different subunits.
7. The oligomer of claim 4 comprising at least two identical subunits.
8. The oligomer of claim 6 wherein at least one subunit is an antibody having a different specificity than the polypeptide of SEQ ID NO:1.
9. The oligomer of claim 6 wherein at least one subunit has an enzymatic function.
10. The oligomer of claim 6 wherein at least one subunit comprises a cargo substance.
11. The isolated single V H domain antibody of claim 1 , wherein the sequence comprises SEQ ID NO.1.
12. The single V H domain antibody of claim 1 , wherein the CDR appear in the order listed, and wherein there is a gap of 12 to 16 amino acids between KNLMG SEQ ID NO.4 and TISGSGGTNYASSVEG SEQ ID NO.6, 30 to 34 amino acids between TISGSGGTNYASSVEG SEQ ID NO.6 and AFAI SEQ ID NO.3, and 46 to 66 amino acids between KNLMG SEQ ID NO.4 and AFAI SEQ ID NO.3.
13. The single V H domain antibody of claim 1 , comprising the sequence:
DVQLQASGGGX 1 VQPGGSLRLSCAAHDPIFDKNLMGWX 2 RQAPGKX 3 X 4 EX 5 VATISG SGGTNYASSVEGRFTISRDNAKKTVYLQMNDLKPEDTAVYYCNSAFAIX 6 GQGTQVT VSS SEQ ID NO.5
wherein X 1 , is: V, S, D, L, F, W, or T; X 2 is: G, F, Y, V, I, H, or L; X 3 is: Q, G, E, D, L, R, or K; X 4 is: R, C, Q, L, I, P, or K; X 5 is: Y, T, A, W, F, S, or L; X 6 is: W, R, E, A, G, V, or K.
14. The single V H domain antibody of claim 1 , wherein the sequence comprises SEQ ID NO:2.
15. The oligomer of claim 4 , wherein the isolated single V H domain antibody comprises the sequence of SEQ ID NO:1.
16. The oligomer of claim 4 , wherein the isolated single V H domain antibody comprises the sequence of SEQ ID NO:2.