Anti-ICAM-1 single domain antibody and uses thereof
Anti-ICAM-1 V H H single-domain antibodies (sdAbs) are generated by immunizing a llama with recombinant ICAM-1. These antibodies are linked to an imaging moiety for in vivo or ex vivo imaging of ICAM-1-related pathological conditions including atherosclerotic plaques. The antibodies may also be linked to a therapeutic agent to specifically target and treat ICAM-1-related pathological conditions.
1. An isolated or purified antibody or fragment thereof that specifically binds to intercellular adhesion molecule 1 (ICAM-1), comprising
the sequence of complementarity determining region (CDR) 1 selected from sequences LYVMG (SEQ ID NO:1), AFRMG (SEQ ID NO:2), and INDMG (SEQ ID NO:3);
the sequence of CDR2 selected from sequences DITSSGSIYYVDSLKG (SEQ ID NO:4), VITAGGTTSYIDSVKG (SEQ ID NO:5), and RITRDGSAAYEDSVKG (SEQ ID NO:6); and
the sequence of CDR3 selected from sequences HVRQDSGSEYLTY (SEQ ID NO:7), IDYDS (SEQ ID NO:8), and EIITTQTLGRMLGEY (SEQ ID NO:9).
2. The isolated or purified antibody or fragment thereof of claim 1 , comprising a CDR1 of sequence LYVMG (SEQ ID NO:1), a CDR2 of sequence DITSSGSIYYVDSLKG (SEQ ID NO:4), and a CDR3 of sequence HVRQDSGSEYLTY (SEQ ID NO:7).
3. The isolated or purified antibody or fragment thereof of claim 1 , comprising a CDR1 of sequence AFRMG (SEQ ID NO:2), a CDR2 of sequence VITAGGTTSYIDSVKG (SEQ ID NO:5), and a CDR3 of sequence IDYDS (SEQ ID NO:8).
4. The isolated or purified antibody or fragment thereof of claim 1 , comprising a CDR1 of sequence INDMG (SEQ ID NO:3), a CDR2 of sequence RITRDGSAAYEDSVKG (SEQ ID NO:6), and a CDR3 of sequence EIITTQTLGRMLGEY (SEQ ID NO:9).
5. The isolated or purified antibody or fragment thereof of claim 1 , wherein the isolated or purified antibody or fragment thereof is a single-domain antibody (sdAb).
6. The isolated or purified antibody or fragment thereof of claim 5 , wherein the sdAb is of camelid origin.
7. The isolated or purified antibody or fragment thereof of claim 1 comprising the sequence:
(SEQ ID NO: 10)
QVQLVESGGGLVQPGGSLRLSCAASGSISSLYVMGWYRQAPGKQRELV
ADITSSGSIYYVDSLKGRFTISRDNARSTVYLQMNSLEPEDTAVYYCM
AHVRQDSGSEYLTYWGQGTQVTVSS,
(SEQ ID NO: 11)
QVKLEESGGGLVQAGDSLRLSCAASGRTVNAFRMGWYRQAPGKQRERV
AVITAGGTTSYIDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCA
AIDYDSRGQGTQVTVSS,
or
(SEQ ID NO: 12)
QVKLEESGGGLVQPGGSLRLSCAASGSIFSINDMGWYRQAPGKQRELV
ARITRDGSAAYEDSVKGRFTISRDNAPNTVFLQMNGLKPEDTAVYYCN
AEIITTQTLGRMLGEYWGQGTQVTVSS.
8. A targeted therapeutic agent comprising the isolated or purified antibody or fragment thereof of claim 1 linked to a therapeutic.
9. The targeted therapeutic agent of claim 8 , wherein the therapeutic agent treats conditions selected from the group consisting of carotid artery disease, stroke, myocardial infarction, inflammatory bowel disease, autoimmune diseases, multiple sclerosis, Crohn's disease, and neovascularization associated with tumour angiogenesis.
10. A molecular imaging agent comprising the isolated or purified antibody or fragment thereof of claim 1 linked to a detectable agent.
11. The molecular imaging agent of claim 10 , wherein the detectable agent is selected from the group consisting of a radioisotope, a paramagnetic label, a fluorophore, an echogenic microbubble, an affinity label, and an enzyme.
12. The molecular imaging agent of claim 10 , wherein the detectable agent is a near infrared fluorescence (NIRF) imaging dye.
13. An ex vivo method of detecting atherosclerotic plaques, comprising:
a) providing a tissue sample suspected of inflammation and plaque formation;
b) contacting said sample with the isolated or purified antibody or fragment thereof of claim 1 under suitable conditions; and
c) detecting the formation of a protein complex,
wherein the isolated or purified anti-ICAM-1 antibody or fragment thereof binds to the tissue sample comprising atherosclerotic plaque formation at a higher rate than that of a control sample.
14. The ex vivo method of claim 13 , wherein the step of detecting (step c)) is accomplished by optical imaging, immunohistochemistry, molecular diagnostic imaging, or ELISA.
15. An in vivo method of detecting atherosclerotic plaques, comprising:
a) administering the molecular imaging agent of claim 10 to a subject;
b) allowing the molecular imaging agent to bind to ICAM-1, wherein the molecular imaging agent binds to binds ICAM-1 in atherosclerotic plagues in vivo at a detectably higher rate than the rate of binding to normal vasculature; and
c) detecting the binding of the molecular imaging agent,
wherein the binding of said molecular imaging agent to the vasculature is indicative of the presence of atherosclerotic plaques.
16. The in vivo method of claim 15 , wherein the step of detecting (step b)) is accomplished by non-invasive optical imaging, ultrasound, MRI, PET, or SPECT.
17. A method for detecting ICAM-1 overexpression in a patient, said method comprising administering an effective amount of the molecular imaging agent of claim 10 to the patient and detecting ICAM-1 bound to the imaging agent.
18. The method of claim 17 , wherein the patient has vascular inflammation, stroke, cancer, or angiogenesis.
19. The method of claim 17 , wherein the step of detecting is accomplished by non-invasive optical imaging, ultrasound, MRI, PET, or SPECT.