Cell-penetrating peptides
A cell-penetrating peptide is described. Also described is a pro-apoptotic agent including the cell-penetrating peptide and a pro-apoptotic peptide linked thereto. The pro-apoptotic agent is useful for inhibition of in vitro cell proliferation and for treatment of tumors.
1. An isolated peptide consisting of the amino acid sequence VKKKKIKAEIKI (SEQ ID NO:2).
2. An isolated peptide consisting of the amino acid sequence VKKKKIKKEIKI (SEQ ID NO:10).
3. An isolated peptide consisting of the amino acid sequence VKKKKIKNEIKI (SEQ ID NO:11).
4. An isolated peptide consisting of the amino acid sequence VKKKKIKAEIKIYVETLDDIFEQWAHSEDL (SEQ ID NO:4).
5. An isolated peptide consisting of the amino acid sequence VKKKKIKAEIKIYIETLDDILEQWARSEDL (SEQ ID NO:5).