Anti-tumor adjuvant therapy
A chimeric peptide construct having a cell penetrating peptide linked to a pro-apoptotic peptide. The construct can be used for treating a tumor in combination with an anti-tumor agent. Also disclosed is a method for treating a tumor with the chimeric peptide construct and a chemotherapeutic agent.
1. A chimeric peptide construct for use in treating a tumor in combination with an anti-tumor agent, wherein the chimeric peptide construct is selected from the group consisting of:
(SEQ ID NO: 29)
VKKKKIKREIKI-YVETLDDIFEQWAHSEDL,
(SEQ ID NO: 30)
VKKKKIKREIKI-YIETLDDILEQWARSEDL,
(SEQ ID NO: 31)
VKKKKIKAEIKI-YVETLDDIFEQWAHSEDL,
(SEQ ID NO: 32)
VKKKKIKAEIKI-YIETLDDILEQWARSEDL,
(SEQ ID NO: 33)
VKKKKIKKEIKI-YVETLDDIFEQWAHSEDL,
(SEQ ID NO: 34)
VKKKKIKKEIKI-YIETLDDILEQWARSEDL,
(SEQ ID NO: 35)
VKKKKIKNEIKI-YVETLDDIFEQWAHSEDL,
and
(SEQ ID NO: 36)
VKKKKIKNEIKI-YIETLDDILEQWARSEDL.
2. A method of treating a tumor, comprising administering to a subject in need thereof the chimeric peptide construct according to claim 1 and an anti-tumor agent, wherein the tumor is a cancer selected from the group consisting of acute myelogenous leukaemia, chronic lymphocytic leukaemia, multiple myeloma, Hodgkin's disease, non-Hodgkin's lymphoma, B cell, cutaneous T cell lymphoma, uveal melanoma, melanoma and brain, lung, breast, ovarian, head and neck, bladder, gastric, pancreatic, head, neck, renal, prostate, colorectal, oesophageal, and thyroid cancer.
3. The method of claim 2 , wherein the chimeric peptide construct and the anti-tumor agent are sequentially administered.
4. The method of claim 2 , wherein the anti-tumor agent is a chemotherapeutic agent.
5. The method of claim 4 , wherein the chemotherapeutic agent is doxorubicin and/or cyclophosphamide.
6. The method of claim 4 , wherein the chemotherapeutic agent is docetaxel, 5-FU, or cisplatin.
7. The method of claim 5 , wherein the tumor is a breast cancer.
8. The method of claim 4 , wherein the peptide construct is administered after a period of about 5 to about 30 days after the chemotherapeutic agent is administered.
9. A method of reducing the risk of relapse of a tumor, comprising administering to a subject in need thereof the chimeric peptide construct according to claim 1 and an anti-tumor agent.