IL-17A binding molecules and medical uses thereof
The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X 1 )(X 2 )(X 3 )(X 4 )(X 5 )(X 6 ) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X 1 ) to (X 6 ) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X 1 ) to (X 6 ) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
1. A polypeptide that inhibits the activity of glycosylated IL-17A comprising:
(a) a peptide consisting of the amino acid sequence of
(SEQ ID NO: 1)
GVTLFVALYDY(X 1 )(X 2 )(X 3 )(X 4 )(X 5 )(X 6 )DLSFHKGEKFQIL
STHEYE DWWEARSLTTGETGYIPSNYVAPVDSIQ,
wherein amino acid positions (X 1 ) to (X 6 ) may be any amino acid sequence; or
(b) a peptide that is at least 85% identical to the peptide of the amino acid sequence of (a),
wherein the identity determination excludes amino acid positions (X 1 ) to (X 6 ) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved.
2. The polypeptide of claim 1 , wherein
(X 1 ) is A, K, S, D or E;
(X 2 ) is N, Q, A, K, S or R;
(X 3 ) is H, K, R, L or V;
(X 4 ) is G or S;
(X 5 ) is H, Q, A, W, V or N; and
(X 6 ) is R, L or S.
3. The polypeptide of claim 1 , wherein the polypeptide comprises a peptide consisting of the amino acid sequence of any one of SEQ ID NOs 3, 4, 5, 6, 7, 8, or 9.
4. A fusion construct comprising a polypeptide of claim 1 fused to a further compound.
5. The fusion construct of claim 4 , wherein the further compound is a pharmaceutically active compound, a prodrug, a pharmaceutically-acceptable carrier, a diagnostically active compound, a cell penetrating enhancer, a compound modulating serum half-life, or a combination thereof.
6. The fusion construct of claim 4 , wherein the further compound is
(a) a fluorescent dye,
(b) a photosentisizer,
(c) a radionuclide,
(d) a contrast agent for medical imaging,
(e) a cytokine,
(f) a toxic compound,
(g) a chemokine,
(h) a pro-coagulant factor,
(i) an enzyme for pro-drug activation,
(k) an albumin binder,
(l) an albumin,
(m) an IgG binder, or
(n) polyethylene glycol.
7. The fusion construct of claim 4 , wherein the further compound is an antibody light chain, an antibody heavy chain, an F c domain of an antibody, an antibody, or a combination thereof.
8. The fusion construct of claim 7 , wherein the further compound is located at the N-terminus of the polypeptide.
9. The fusion construct of claim 7 , wherein the further compound comprises an antibody light chain comprising the amino acid sequence of SEQ ID NO: 11.
10. A construct comprising at least one copy of a fusion construct of claim 9 and at least one copy of the antibody heavy chain of SEQ ID NO: 12.
11. The construct of claim 10 , wherein the construct comprises at least one copy of a fusion construct comprising the amino acid sequence of SEQ ID NO: 16 or 17 and at least one copy of the antibody heavy chain of the amino acid sequence of SEQ ID NO: 12.
12. A nucleic acid molecule encoding a polypeptide of claim 1 .
13. A method of treating an inflammatory disease comprising administering a pharmaceutical composition comprising a polypeptide of claim 1 , wherein the disease is psoriatic arthritis, psoriasis, rheumatoid arthritis, or autoimmune inflammatory bowel disease.
14. The fusion construct of claim 7 , wherein the further compound comprises an antibody that specifically binds to TNFα.
15. A construct comprising two copies of a fusion construct of claim 9 and two copies of the antibody heavy chain of the amino acid sequence of SEQ ID NO: 12.
16. The construct of claim 10 , wherein the construct comprises at least one copy of a fusion construct comprising the amino acid sequence of SEQ ID NO: 17 and at least one copy of the antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 12.
17. The construct of claim 11 , wherein the construct comprises two copies of a fusion construct comprising the amino acid sequence of SEQ ID NO: 16 and two copies of the antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 12.
18. The construct of claim 16 , wherein the construct comprises two copies of a fusion construct comprising the amino acid sequence of SEQ ID NO: 17 and two copies of the antibody heavy chain comprising the amino acid sequence of SEQ ID NO: 12.