Method for the treatment of multiple myeloma or non-Hodgkins lymphoma with anti-CD38 antibody and bortezomib or carfilzomib
A method of treating multiple myeloma or non-hodgkins lymphoma with a pharmaceutical composition comprising an anti-CD38 antibody and bortezomib or carfilzomib is disclosed.
1. A method for treating multiple myeloma or non-hodgkins lymphoma in a subject in need thereof, wherein said method comprises administering to the subject a therapeutically effective amount of a combination of: (i) bortezomib or carfilzomib, (ii) an antibody specific for CD38, comprising an HCDR1 region of sequence SYYMN (SEQ ID NO: 14) or GFTFSSYYMN (SEQ ID NO: 1), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 2), an HCDR3 region of sequence DLPLVYTGFAY (SEQ ID NO: 3), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 4), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 5), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 6).
2. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence SYYMN (SEQ ID NO: 14).
3. The method of claim 1 , wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1).
4. The method of claim 1 , wherein said antibody comprises a variable heavy chain of the sequence:
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVS GISGDP SNTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLPLVYT GF AYWGQGTLVTVSS (SEQ ID NO: 10);
and a variable light chain of the sequence:
DIELTQPPSVSVAPGQTARISCSGDNLRHYYVYWYQQKPGQAPVLVIYGD SKRPS GIPERFSGSNSGNTATLTISGTQAEDEADYYCQTYTGGASLVFGGGTKLT VLGQ (SEQ ID NO: 11).
5. The method of claim 1 , wherein said antibody is an IgG antibody.
6. The method of claim 1 , wherein said antibody comprises an IgG1 Fc region.
7. The method of claim 1 , wherein said antibody comprises a modified Fc region, wherein said modification enhances ADCC activity.
8. The method of claim 1 , wherein said combination comprises said antibody and bortezomib.
9. The method of claim 8 , wherein said cancer is multiple myeloma.
10. The method of claim 1 , wherein said combination comprises said antibody and carfilzomib.
11. The method of claim 10 , wherein said cancer is multiple myeloma.
12. The method of claim 1 , wherein said antibody and said bortezomib or carfilzomib are administered separately.
13. The method of claim 12 , wherein said antibody and said bortezomib are administered separately.
14. The method of claim 12 , wherein said antibody and said carfilzomib are administered separately.