Serum half-life extension using IgBD
The present invention relates to complexes comprising (i) an immunoglobulin (Ig) binding moiety and (ii) a pharmaceutically active moiety, wherein the Ig binding moiety specifically binds to the constant domain 1 of the heavy chain (C H 1) of an Ig molecule and their use for therapy and prophylaxis.
1. An immunoglobulin (Ig) binding moiety comprising a C H 1 binding-immunoglobulin binding domain (IgBD) of a streptococcal protein G, which is a variant of SEQ ID NO: 1, wherein the three amino acids Glu26, Lys27, and Lys30 of SEQ ID NO: 1 are substituted with Ala and which may have up to 3 further amino acid substitutions, wherein the Ig binding moiety specifically binds to the constant domain 1 of the heavy chain (C H 1) of an Ig molecule wherein the variant has the amino acid sequence TTYKLVINGKTLKGETTTKAVDAETAAAAFAQYANDNGVDGVWTYDDATKTFTVTE (SEQ ID NO: 3).
2. An immunoglobulin (Ig) binding moiety comprising a C H 1 binding-immunoglobulin binding domain (IgBD) of a streptococcal protein G, which is a variant of SEQ ID NO: 1, wherein the three amino acids Glu26, Lys27, and Lys30 of SEQ ID NO: 1 are substituted with Ala and which may have up to 3 further amino acid substitutions, wherein the Ig binding moiety specifically binds to the constant domain 1 of the heavy chain C H 1 of an Ig molecule wherein the variant consists of the amino acid sequence TTYKLVINGKTLKGETTTKAVDAETAAAAFAQYANDNGVDGVWTYDDATKTFTVTE (SEQ ID NO: 3).
3. A nucleic acid molecule comprising a sequence encoding the Ig binding moiety of claim 1 or 2 .
4. A vector comprising the nucleic acid of claim 3 .
5. A cell comprising the Ig binding moiety of claim 1 or 2 , the nucleic acid of claim 3 and/or the vector of claim 4 .
6. A method for forming a complex comprising the step of contacting the Ig binding moiety of claim 1 or 2 with a pharmaceutically active moiety comprising a C H 1 of an Ig molecule.