IP Library Granted Patent US 11,466,253
Granted Patent B2
US 11,466,253 · App. 15/770,179 · Granted Oct 11, 2022

Methods for culturing cells and kits and apparatus for same

Inventors: Lothar Germeroth (Munich, DE); Christian Stemberger (Munich, DE); Patricia Gräf (Munich, DE); Keenan Bashour (Seattle, WA)
Assignee: Juno Therapeutics GmbH
C12N5/0636A61K35/17A61K2039/5158C12N2501/51C12N2501/515C12N2501/998C12N2533/20C12N2533/50
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 11,466,253
App. No.
15/770,179
Granted
Oct 11, 2022
Kind
B2
Abstract

Provided herein are methods that relate, in some aspects, to the incubation or culturing, such as to induce stimulation of expansion (proliferation), activation, costimulation and/or survival, of a composition of cells, such as a population of lymphocytes. In some aspects, provided are methods and reagents for the stimulation, e.g., of expansion (proliferation), survival or persistence, activation, costimulation, or other effect, of cell populations that involve binding of agents to a molecule on the surface of the cells, thereby providing one or more signals to the cells. In some cases, the reagents are reagents containing a plurality of binding sites for agents, such as multimerization reagents, and thus the one or more agents are multimerized by reversibly binding to the reagent, e.g., thereby creating a stimulatory reagent (multimerized agent), having stimulatory agents multimerized thereon. In some aspects, the multimerized agent can provide for expansion or proliferation or other stimulation of a population of cells, and then such stimulatory agents can be removed by disruption of the reversible bond. Also provided are compositions, apparatus and methods of use thereof.

Claims (84)

1. A method for culturing T cells, the method comprising:

(a) incubating a composition comprising CD3+ T cells in the presence of a first receptor-binding agent and a second receptor-binding agent, wherein:

the first receptor-binding agent (i) is reversibly bound to a soluble reagent via a first binding partner comprised by the first receptor-binding agent and (ii) comprises an anti-CD3 antibody or antibody fragment or a proteinaceous CD3 binding molecule that specifically binds to a CD3 molecule on the surface of the CD3+ T cells in a manner that induces a TCR/CD3 complex-associated signal in CD3+ T cells in the composition,

the second receptor-binding agent (i) is reversibly bound to the reagent via a second binding partner comprised by the second receptor-binding agent and (ii) comprises an anti-CD28 antibody or antibody fragment or a proteinaceous CD28 binding molecule that specifically binds to a CD28 molecule on the surface of the CD3+ T cells in a manner that induces a costimulatory signal in CD3+ T cells in the composition,

the reagent is soluble in a culture medium and is not immobilized on a solid support, and

the incubation effects the stimulation or expansion of T cells in the composition; and

(b) disrupting the reversible binding between the first receptor-binding agent and the reagent and the second receptor-binding agent and the reagent on any of days 1-5 after initiation of said incubation, thereby generating cultured CD3+ T cells wherein the reagent comprises a streptavidin mutein or an avidin mutein that reversibly binds to biotin, a biotin analog, or a streptavidin-binding peptide.

2. The method of claim 1 , wherein the CD3+ T cells are primary cells from a subject.

3. The method of claim 1 , wherein the reagent comprises an oligomer or polymer of a streptavidin mutein.

4. The method of claim 1 , wherein the reagent comprises a streptavidin mutein comprising the amino acid sequence Val 44 -Thr 45 -Ala 46 -Arg 47 or Ile 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: 1.

5. The method of claim 1 , wherein the reagent comprises a streptavidin mutein that comprises:

(a) the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 and 28;

(b) a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more sequence identity to any of SEQ ID NOS: 3-6, 27 and 28; contains the amino acid sequence corresponding to Val 44 -Thr 45 -Ala 46 -Arg 47 or Ile 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO:1; and reversibly binds to biotin, a biotin analog, or a streptavidin-binding peptide; or

(c) a functional fragment of (a) or (b) that reversibly binds to biotin, a biotin analog, or a streptavidin-binding peptide.

6. The method of claim 1 , wherein:

the first binding partner comprises a streptavidin-binding peptide selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)3-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 17), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 18), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2Gly-Gly-Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 19), Trp-Arg-His-Pro-Gln-Phe-Gly-Gly (SEQ ID NO: 7), SAWSHPQFEKGGGSGGGSGGGSWSHPQFEK (SEQ ID NO: 15), and SAWSHPQFEK(GGGS) 2 GGSAWSHPQFEK (SEQ ID NO: 16); and

the reagent comprises a streptavidin mutein that reversibly binds to the streptavidin-binding peptide.

7. The method of claim 1 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising a substance capable of reversing the bond between the first receptor-binding agent and the reagent and the second receptor-binding agent and the reagent.

8. The method of claim 7 , wherein:

the reagent comprises a streptavidin mutein; and

the substance comprises a streptavidin-binding peptide, biotin, or a biotin analog.

9. The method of claim 1 , wherein said disruption is carried out between about 1 day and about 3 days after initiation of said incubation.

10. The method of claim 1 , wherein said disruption is carried out about 2 days after initiation of said incubation.

11. The method of claim 1 , wherein the first binding partner comprises a streptavidin-binding peptide comprising the sequence set forth in SEQ ID NO: 16, and the reagent comprises a streptavidin mutein that reversibly binds to the streptavidin-binding peptide.

12. The method of claim 7 , wherein:

the reagent comprises a streptavidin mutein; and

the substance comprises D-biotin.

13. The method of claim 1 , wherein the first receptor-binding agent comprises an anti-CD3 antibody or antibody fragment, and the second receptor-binding agent comprises an anti-CD28 antibody or antibody fragment.

14. The method of claim 1 , wherein the first receptor-binding agent comprises an anti-CD3 antibody fragment, and the second receptor-binding agent comprises an anti-CD28 antibody fragment.

15. The method of claim 13 , wherein the reagent comprises a streptavidin mutein comprising the amino acid sequence Val 44 -Thr 45 -Ala 46 -Arg 47 or Ile 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO:1.

16. The method of claim 13 , wherein the reagent comprises a streptavidin mutein that comprises:

(a) the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 and 28;

(b) a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more sequence identity to any of SEQ ID NOS: 3-6, 27 and 28; contains the amino acid sequence corresponding to Val 44 -Thr 45 -Ala 46 -Arg 47 or Ile 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO:1; and reversibly binds to biotin, a biotin analog, or a streptavidin-binding peptide; or

(c) a functional fragment of (a) or (b) that reversibly binds to biotin, a biotin analog, or a streptavidin-binding peptide.

17. The method of claim 13 , wherein:

the first binding partner comprises a streptavidin-binding peptide comprising the sequence set forth in any of SEQ ID NOs: 7, 8, and 15-19;

the second binding partner comprises a streptavidin-binding peptide comprising the sequence set forth in any of SEQ ID NOs: 7, 8, and 15-19; and

the reagent comprises a streptavidin mutein that reversibly binds to the streptavidin-binding peptides of the first and second binding partners.

18. The method of claim 13 , wherein the first and second binding partners each comprise a streptavidin-binding peptide comprising the sequence set forth in SEQ ID NO: 16, and the reagent comprises a streptavidin mutein that reversibly binds to the streptavidin-binding peptide.

19. The method of claim 13 , wherein said disruption is carried out between about 1 day and about 3 days after initiation of said incubation.

20. The method of claim 13 , wherein said disruption is carried out about 2 days after initiation of said incubation.

21. The method of claim 13 , wherein:

the reagent comprises a streptavidin mutein; and

said disruption comprises introducing to the CD3+ T cells a composition comprising a streptavidin-binding peptide, biotin, or a biotin analog capable of reversing the bond between the first and second receptor-binding agents and the reagent.

22. The method of claim 13 , wherein:

the reagent comprises a streptavidin mutein; and

said disruption comprises introducing to the CD3+ T cells a composition comprising D-biotin.

23. The method of claim 18 , wherein said disruption is carried out between about 1 day and about 3 days after initiation of said incubation.

24. The method of claim 18 , wherein said disruption is carried out about 2 days after initiation of said incubation.

25. The method of claim 18 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising a streptavidin-binding peptide, biotin, or a biotin analog capable of reversing the bond between the first and second receptor-binding agents and the reagent.

26. The method of claim 18 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising D-biotin.

27. The method of claim 1 , wherein:

the second binding partner comprises a streptavidin-binding peptide selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)3-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 17), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 18), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2Gly-Gly-Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 19), Trp-Arg-His-Pro-Gln-Phe-Gly-Gly (SEQ ID NO: 7), SAWSHPQFEKGGGSGGGSGGGSWSHPQFEK (SEQ ID NO: 15), and SAWSHPQFEK(GGGS) 2 GGSAWSHPQFEK (SEQ ID NO: 16); and

the reagent comprises a streptavidin mutein that reversibly binds to the streptavidin-binding peptide.

28. The method of claim 4 , wherein the streptavidin mutein comprises the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 and 28.

29. The method of claim 15 , wherein the streptavidin mutein comprises the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 and 28.

30. The method of claim 17 , wherein the streptavidin mutein comprises the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 and 28.

31. The method of claim 23 , wherein the streptavidin mutein comprises the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 and 28.

32. The method of claim 14 , wherein the antibody fragment is a divalent antibody fragment selected from a F(ab′) 2 -fragment and a divalent single-chain Fv (scFv) fragment.

33. The method of claim 14 , wherein the antibody fragment is a monovalent antibody fragment selected from a Fab fragment, an Fv fragment, and an scFv fragment.

34. The method of claim 14 , wherein the antibody fragment is a Fab fragment.

35. The method of claim 1 , wherein each of the first and second receptor-binding agent comprises a proteinaceous binding molecule with antibody-like binding properties independently selected from aptamers, muteins based on a polypeptide of the lipocalin family, glubodies, proteins based on the ankyrin scaffold, proteins based on the crystalline scaffold, adnectins, and avimers.

36. The method of claim 30 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising biotin or a biotin analog capable of reversing the bond between the first and second receptor-binding agents and the reagent.

37. The method of claim 30 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising D-biotin.

38. The method of claim 17 , wherein the streptavidin mutein comprises the amino acid sequence Val 44 -Thr 45 -Ala 46 -Arg 47 or Ile 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO:1.

39. The method of claim 38 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising biotin or a biotin analog capable of reversing the bond between the first and second receptor-binding agents and the reagent.

40. The method of claim 38 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising D-biotin.

41. The method of claim 34 , wherein the reagent comprises a streptavidin mutein comprising the amino acid sequence Val 44 -Thr 45 -Ala 46 -Arg 47 or Ile 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO:1.

42. The method of claim 34 , wherein the reagent comprises a streptavidin mutein comprising the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 and 28.

43. The method of claim 34 , wherein:

the first binding partner comprises a streptavidin-binding peptide comprising the sequence set forth in any of SEQ ID NOs: 7, 8, and 15-19;

the second binding partner comprises a streptavidin-binding peptide comprising the sequence set forth in any of SEQ ID NOs: 7, 8, and 15-19; and

the reagent comprises a streptavidin mutein that reversibly binds to the streptavidin-binding peptides of the first and second binding partners.

44. The method of claim 34 , wherein the first binding partner comprises a streptavidin-binding peptide comprising the sequence set forth in SEQ ID NO: 16, and the reagent comprises a streptavidin mutein that reversibly binds to the streptavidin-binding peptide.

45. The method of claim 43 , wherein the streptavidin mutein comprises the amino acid sequence Val 44 -Thr 45 -Ala 46 -Arg 47 or Ile 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO:1.

46. The method of claim 43 , wherein the streptavidin mutein comprises the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 and 28.

47. The method of claim 43 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising biotin or a biotin analog capable of reversing the bond between the first and second receptor-binding agents and the reagent.

48. The method of claim 43 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising D-biotin.

49. The method of claim 36 , wherein the first and second binding partners each comprise a streptavidin-binding peptide comprising the sequence set forth in SEQ ID NO: 16.

50. The method of claim 37 , wherein the first and second binding partners each comprise a streptavidin-binding peptide comprising the sequence set forth in SEQ ID NO: 16.

51. The method of claim 17 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising biotin or a biotin analog capable of reversing the bond between the first and second receptor-binding agents and the reagent.

52. The method of claim 17 , wherein said disruption comprises introducing to the CD3+ T cells a composition comprising D-biotin.

53. The method of claim 39 , wherein the first and second binding partners each comprise a streptavidin-binding peptide comprising the sequence set forth in SEQ ID NO: 16.

54. The method of claim 40 , wherein the first and second binding partners each comprise a streptavidin-binding peptide comprising the sequence set forth in SEQ ID NO: 16.

Assignments (4)
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Apr 17, 2025
From: JUNO THERAPEUTICS GMBH
To: JUNO THERAPEUTICS, INC.
Reel/Frame 070871/0157 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jul 29, 2019
From: BASHOUR, KEENAN
To: JUNO THERAPEUTICS, INC.
Reel/Frame 049892/0812 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jul 29, 2019
From: JUNO THERAPEUTICS, INC.
To: JUNO THERAPEUTICS GMBH
Reel/Frame 049892/0832 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Jul 29, 2019
From: GERMEROTH, LOTHAR; STEMBERGER, CHRISTIAN; GRAF, PATRICIA
To: JUNO THERAPEUTICS GMBH
Reel/Frame 049892/0855 →
Continuity (3)
Provisional Application 62245261 · Oct 22, 2015
Provisional Application 62245252 · Oct 22, 2015
Related Publication 20190136186A1 · May 9, 2019
Cited By (4)
US 12,258,580 US 12,516,099 US 12,522,660 US 12,553,024