IP Library › Granted Patent US 11,939,394
Granted Patent B2
US 11,939,394 · App. 15/770,317 · Granted Mar 26, 2024

Binding molecules that inhibit cancer growth

Inventors: Mark Throsby (Utrecht, NL); Ton Logtenberg (Utrecht, NL); Johannes Carolus Clevers (Utrecht, NL); Robert Gerhardus Jacob Vries (Utrecht, NL); Eduard Batlle (Barcelona, ES); Bram Herpers (Leiden, NL)
Assignees: Merus N.V.; Fundacio Institut de Recerca Biomedica; Institució Catalana de Recerca I Estudis Avancats
C07K16/3046C07K16/28C07K16/30C07K2317/31C07K2317/34C07K2317/55C07K2317/76C07K2317/92
View Patent ↗
Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US 11,939,394
App. No.
15/770,317
Granted
Mar 26, 2024
Kind
B2
Abstract

The invention provides means and methods for inhibiting growth of a cancer. The means in some embodiments comprise proteins and antibodies that binds an extracellular part of a membrane associated member of the epidermal growth factor (EGF) receptor family and an extracellular part of a membrane associated member of a WNT signaling pathway. Further provided are various cells and assays that are helpful in the production of the proteins, antibodies and cells.

Claims (47)

1. A bispecific antibody that comprises a variable domain that binds an extracellular part of EGFR and a variable domain that binds an extracellular part of LGR5, wherein

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAMN (SEQ ID NO:188), WINANTGDPTYAQGFTG (SEQ ID NO: 215), and ERFLEWLHFDY (SEQ ID NO: 242); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SSSSYWG (SEQ ID NO: 192), SFYYSGNTYYNPSLKS (SEQ ID NO: 220), and TYSSSWDGVLYYFDY (SEQ ID NO:247);

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAMN (SEQ ID NO: 188), WINANTGDPTYAQGFTG (SEQ ID NO: 215) and ERFLEWLHFDY (SEQ ID NO: 242); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences TYYWS (SEQ ID NO: 193), YVYYTGRTKYNPSLKS (SEQ ID NO: 221) and GGIVVVPAARDYYYYMDV (SEQ ID NO: 248);

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAMN (SEQ ID NO: 188), WINANTGDPTYAQGFTG (SEQ ID NO: 215) and ERFLEWLHFDY (SEQ ID NO: 242), and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SHWIG (SEQ ID NO: 194), VIYPGDSDTRYSPSFQG (SEQ ID NO: 222) and PNSGSPRYFEF (SEQ ID NO:249);

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAMN (SEQ ID NO: 188), WINANTGDPTYAQGFTG (SEQ ID NO: 215), and ERFLEWLHFDY (SEQ ID NO: 242), and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SHWIA (SEQ ID NO: 196), IVYPGDSDTRYSPSFQG (SEQ ID NO: 224), and HEWELLGPFDY (SEQ ID NO: 251);

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAMN (SEQ ID NO: 188), WINANTGDPTYAQGFTG (SEQ ID NO: 215), and ERFLEWLHFDY (SEQ ID NO: 242) and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences NDAIS (SEQ ID NO: 197), SIIPILDTTDHAQKFQG (SEQ ID NO: 225), and EHIAARQDYFDY (SEQ ID NO: 252);

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAMN (SEQ ID NO: 188), WINANTGDPTYAQGFTG (SEQ ID NO: 215), and ERFLEWLHFDY (SEQ ID NO: 242); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SYTMN (SEQ ID NO: 198), WINTDTGDPTYAQGFTG (SEQ ID NO: 226), and GDCDSTSCYRYSYGYEDY (SEQ ID NO: 253);

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAMN (SEQ ID NO:188), WINANTGDPTYAQGFTG (SEQ ID NO: 215), and ERFLEWLHFDY (SEQ ID NO: 242); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SYAIS (SEQ ID NO: 199), GIIPIFDTRNYAQILQG (SEQ ID NO: 227), and GSDEGDWFDP (SEQ ID NO: 254);

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAMN (SEQ ID NO:188), WINANTGDPTYAQGFTG (SEQ ID NO: 215), and ERFLEWLHFDY (SEQ ID NO: 242); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences NYAIS (SEQ ID NO: 200), SIIPILGTTDHAQKFQD (SEQ ID NO: 228), and EYIAARLDYFDS (SEQ ID NO: 255);

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences ELSMH (SEQ ID NO: 189), GFDPEYGKTFFAQNFQG (SEQ ID NO: 216), and EGYYETTTYYYNLFDS (SEQ ID NO: 243); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SHWIG (SEQ ID NO: 194), VIYPGDSDTRYSPSFQG (SEQ ID NO: 222) and PNSGSPRYFEF (SEQ ID NO: 249);

wherein the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences ELSMH (SEQ ID NO: 189), GFDPEYGKTFFAQNFQG (SEQ ID NO: 216), and EGYYETTTYYYNLFDS (SEQ ID NO: 243); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SYTMN (SEQ ID NO: 198), WINTDTGDPTYAQGFTG (SEQ ID NO:226), and GDCDSTSCYRYSYGYEDY (SEQ ID NO: 253),

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences SYGIS (SEQ ID NO: 187), WISAYNGNTNYAQKLQG (SEQ ID NO: 214), and DRHWHWWLDAFDY (SEQ ID NO: 241); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SHWIG (SEQ ID NO: 194), VIYPGDSDTRYSPSFQG (SEQ ID NO: 222) and PNSGSPRYFEF (SEQ ID NO: 249); or

the VH chain of the variable domain that binds EGFR comprises the CDR1, CDR2 and CDR3 amino acid sequences SYGIS (SEQ ID NO: 187), WISAYNGNTNYAQKLQG (SEQ ID NO: 214), and DRHWHWWLDAFDY (SEQ ID NO: 241); and the VH chain of the variable domain that binds LGR5 comprises the CDR1, CDR2 and CDR3 amino acid sequences SYTMN (SEQ ID NO: 198), WINTDTGDPTYAQGFTG (SEQ ID NO: 226), and GDCDSTSCYRYSYGYEDY (SEQ ID NO: 253);

and wherein the first and second variable domains further comprise the light chain variable domain comprising a CDR1 sequence QSISSY (SEQ ID NO: 299), a CDR2 sequence AAS, and a CDR3 sequence QQSYSTPPT (SEQ ID NO: 300).

2. The bispecific antibody of claim 1 , wherein the light chain variable domain comprises the amino acid sequence

(SEQ ID NO: 80)

DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIY

AASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPTF

GQGTKVEIK

3. A cell comprising the bispecific antibody according to claim 1 .

4. The cell according to claim 3 , wherein said cell produces said antibody.

5. The cell according to claim 3 , wherein said cell is a hybridoma cell, a Chinese hamster ovary (CHO) cell, an NS0 cell or a PER-C6TM cell.

6. A pharmaceutical composition comprising an antibody of claim 1 .

7. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SED ID NO: 20 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region, and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO:24 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

8. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region, and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 44 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

9. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20, having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 46 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

10. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20, having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 50 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

11. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20, having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 52 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

12. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20, having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 26 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

13. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region, and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 54 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

14. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region, and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 56 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

15. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 36 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region, and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 46 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

16. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 36 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region, and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 26 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

17. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 34 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region, and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 46 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

18. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence SEQ ID NO: 34 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 26 having at most 15 amino acid insertions, deletions, substitutions or a combination thereof which are not in the CDR1, CDR2 or CDR3 region.

19. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SED ID NO: 20 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO:24.

20. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 44.

21. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 46.

22. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 50.

23. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 52.

24. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 26.

25. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 20 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 54.

26. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO:20 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 56.

27. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 36 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 46.

28. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 36 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 26.

29. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence of SEQ ID NO: 34 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 46.

30. The bispecific antibody of claim 1 , wherein the VH chain of the variable domain that binds EGFR comprises the amino acid sequence SEQ ID NO: 34 and the VH chain of the variable domain that binds LGR5 comprises the amino acid sequence of SEQ ID NO: 26.

Assignments (8)
NOTICE OF GRANT OF SECURITY INTEREST IN PATENTS Recorded Jan 30, 2026
From: MERUS B.V.
To: WILMINGTON TRUST, NATIONAL ASSOCIATION
Reel/Frame 074562/0322 →
SECURITY INTEREST Recorded Jan 29, 2026
From: MERUS B.V.
To: MORGAN STANLEY SENIOR FUNDING, INC.
Reel/Frame 074532/0434 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Nov 9, 2021
From: KONINKLIJKE NEDERLANDSE AKADEMIE VAN WETENSCHAPPEN
To: MERUS N.V.
Reel/Frame 058056/0032 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Nov 9, 2021
From: OCELLO B.V.
To: MERUS N.V.
Reel/Frame 058056/0094 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 15, 2019
From: THROSBY, MARK; LOGTENBERG, TON
To: MERUS N.V.
Reel/Frame 048343/0206 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 15, 2019
From: BATLLE, EDUARD
To: FUNDACIÓ INSTITUT DE RECERCA BIOMÈDICA (IRB BARCELONA); INSTITUCIÓ CATALANA DE RECERCA | ESTUDIS AVANÇATS
Reel/Frame 048343/0293 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 15, 2019
From: HERPERS, BRAM
To: OCELLO B.V.
Reel/Frame 048343/0147 →
ASSIGNMENT OF ASSIGNOR'S INTEREST Recorded Feb 15, 2019
From: CLEVERS, JOHANNES CAROLUS; VRIES, ROBERT GERHARDUS JACOB
To: KONINKLIJKE NEDERLANDSE AKADEMIE VAN WETENSCHAPPEN
Reel/Frame 048343/0106 →
Priority Claims (2)
EP 15191343 · Oct 23, 2015 · regional
EP 16168647 · May 6, 2016 · regional
Continuity (1)
Related Publication 20180312604A1 · Nov 1, 2018