Anti-transglutaminase 2 antibodies
The invention provides antibodies and antigen-binding fragments thereof that selectively bind to an epitope within the core region of transglutaminase type 2 (TG2). Novel epitopes within the TG2 core are provided. The invention provides human TG2 inhibitory antibodies and uses thereof, particularly in medicine, for example in the treatment and/or diagnosis of conditions including Celiac disease, scarring, fibrosis-related diseases, neurodegenerative/neurological diseases and cancer.
1. A method of inhibiting human transglutaminase type 2 (TG2)-mediated cross-linking of lysine and glutamine with Nε(γ-glutamyl)lysine isopeptide bonds, the method comprising contacting human TG2 with an antibody that comprises the amino acid sequences set forth in SEQ ID NO: 7 (LCDR1), SEQ ID NO: 17 (LCDR2), SEQ ID NO: 9 (LCDR3), SEQ ID NO: 18 (HCDR1), SEQ ID NO: 15 (HCDR2) and SEQ ID NO: 19 (HCDR3).
2. The method of claim 1 , wherein the antibody selectively binds to amino acids 304 to 326 of human TG2 (SEQ ID NO: 2).
3. The method of claim 1 , wherein the antibody comprises at least one light chain variable region comprising the amino acid sequence DITMTQSPSSLSASVGDRVTITCKASQDINSYLTWFQQKPGKAPKILIYLVNRLVDGVPSRFSG SGSGQDYALTISSLQPEDFATYYCLQYDDFPYTFGQGTKVEIK (SEQ ID NO: 73); and/or at least one heavy chain variable region comprising the amino acid sequence EVQLLESGGGLVQPGGSLRLSCAASGFTLSTHAMSWVRQAPGKGLEWVATISSGGRSTYYP DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYFCARLISTYWGQGTLVTVSS (SEQ ID NO: 75), or
an amino acid sequence having at least 90% identity with the amino acid sequence set forth in SEQ ID NO: 73 or the amino acid sequence set forth in SEQ ID NO: 75.
4. The method of claim 1 , wherein the antibody has:
a light chain variable region comprising the sequence
DITMTQSPSSLSASVGDRVTITCKASQDINSYLTWFQQKPGKAPKILIYLVNRLVDGVPS RFSGSGSGQDYALTISSLQPEDFATYYCLQYDDFPYTFGQGTKVEIK (SEQ ID NO: 73), and a heavy chain variable region comprising the sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTLSTHAMSWVRQAPGKGLEWVATISSGGRS TYYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYFCARLISTYWGQGTLVTVSS (SEQ ID NO: 75).
5. The method of claim 1 , wherein the antibody comprises or consists of an intact antibody.
6. The method of claim 1 , wherein the antibody is an antigen-binding fragment selected from the group consisting of: a Fv, a single chain Fv (scFv) or a disulfide-bonded Fv; a Fab; and a Fab-like, a Fab′ or a F(ab) 2 .
7. The method according to claim 1 , wherein the antibody thereof does not inhibit TG1, TG3, TG13 and/or TG7 activity.
8. The method of claim 1 , wherein the antibody is an IgG1, IgG2, IgG3 or IgG4.
9. The method of claim 1 , that is an in vivo method.
10. A method of treating fibrosis in an individual comprising administering an antibody or antigen-binding fragment thereof that comprises the amino acid sequences set forth in SEQ ID NO: 7 (LCDR1), SEQ ID NO: 17 (LCDR2), SEQ ID NO: 9 (LCDR3), SEQ ID NO: 18 (HCDR1), SEQ ID NO: 15 (HCDR2) and SEQ ID NO: 19 (HCDR3).
11. A method of inhibiting human transglutaminase type 2 (TG2)-mediated cross-linking of lysine and glutamine with Nε(γ-glutamyl)lysine isopeptide bonds in an individual, the method comprising administering to an individual in need thereof an antibody or antigen-binding fragment thereof that comprises the amino acid sequences set forth in SEQ ID NO: 7 (LCDR1), SEQ ID NO: 17 (LCDR2), SEQ ID NO: 9 (LCDR3), SEQ ID NO: 18 (HCDR1), SEQ ID NO: 15 (HCDR2) and SEQ ID NO: 19 (HCDR3).