IP Library › Patent Application 16183340
Patent Application
App. No. 16/183,340

Humanized Variable Lymphocyte Receptors (VLR) and Compositions and Uses Related Thereto

Loading inventors, assignments & file history…
Monitor This Case
Get email alerts when status or documents change.
Order Certified Copies
Most orders are placed with the USPTO same day — all within 24 business hours.
Order via The Patent Place →
Pre-filled with this patent's details
Quick Facts
Patent No.
US None
App. No.
16/183,340
Abstract

This disclosure relates to variable lymphocyte receptors (VLRs) modifications such as humanized sequences and polypeptides comprising such sequences that specifically bind a target molecule and uses related thereto. In certain embodiments, the disclosure relates to recombinant polypeptide VLRs disclosed herein and variants thereof. In certain embodiments, this disclosure relates to treating or preventing a disease or condition comprising administering an effective amount of a recombinant polypeptide or variant disclosed herein to a subject in need thereof.

Claims (22)

1 . A recombinant vector comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence XLXLXXNKLQTIAKGTFSPLRAIQXMXLXX (SEQ ID NO: 38) wherein X at each position is individually and independently any amino acid provided that the polypeptide does not contain at least one of the following wild-type Slit2-D2 sequences selected from (SEQ ID NO: 16) LLSLYD, and (SEQ ID NO: 17) TMHLAQ.

2 . The recombinant vector of claim 1 , wherein the polypeptide comprises an amino acid sequence

(SEQ ID NO: 71)

DLHNLNYLDLNNNKLQTIAKGTFSPLRAIQHMWLYQNPFICDC.

3 . The recombinant vector of claim 1 , wherein the polypeptide comprises an amino acid sequence

(SEQ ID NO: 24)

CPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSP

YKKLRRIDLSNNQISELAPDAFQGLRSLNSLDLGGNKITELPKSLFEGLF

SLQLLLLNANKINXLRVDAFQDLHNLNLLSLDDNKLQTIAKGTFSPLRAI

QTMHLAQNPFICDCHLKWLADYLSIAMRWDGKAVNDPDSARCTSPRRLAN

KRIGQIKSKKFRC.

4 . The recombinant vector of claim 1 , wherein the polypeptide comprises an amino acid sequence

(SEQ ID NO: 1)

CPAACTCSNNTVDCRSKGLTEIPTNLPETITIIYLHDNTIKVIPPGAFSP

YKKLREIYLGSNQISELAPDAFQGLRSLNVLDLGTNKITELPKSLFEGLF

SLQELFLCCNKINCLRVDAFQDLHNLNHLALDQNKLQTIAKGTFSPLRAI

QHMYLFGNPFICDCHLKWLADYLHIAMRWDGKAVNDPDSARCTSPRRLAN

KRIGQIKSKKFRC.

5 . The recombinant vector of claim 1 , wherein an X is the amino acid tyrosine.

6 . The recombinant vector of claim 1 , wherein an X is the amino acid selected from phenylalanine (Phe), tryptophan (Trp) and histidine (His).

7 . The recombinant vector of claim 1 , wherein an X is the amino acid selected from asparagine (Asn) and aspartic acid (Asp).

8 . An expression system comprising a vector of claim 1 .