PD1 and/or LAG3 binders
View Patent ↗The present invention provides molecules, such as ISVDs and Nanobodies, that bind to PD1 and LAG3 and, optionally to human serum albumin. These molecules have been engineered so as to reduce the incidence of binding by pre-existing antibodies in the bodies of a subject administered such a molecule. Methods for increasing immune response, treating cancer and/or treating an infectious disease with such molecules are provided.
1. A method for inhibiting lymphocyte activation gene 3 (LAG3) binding to MHC class II comprising contacting said LAG3 with a LAG3 binder comprising an immunoglobulin single variable domain (ISVD) that binds to LAG3 comprising a CDR1 comprising the amino acid sequence GRTFSDYVMG (SEQ ID NO: 65) or DYVMG (amino acids 6-10 of SEQ ID NO: 65); a CDR2 comprising the amino acid sequence AISESGGRTHYADXVKG (SEQ ID NO: 66) or AISESGGRTH (amino acids 1-10 of SEQ ID NO: 66); and a CDR3 comprising the amino acid sequence TLLWWTSEYAPIKANDYDY (SEQ ID NO: 67); and, optionally, a half-life extender and/or a C-terminal extender.
2. The method of claim 1 , wherein the ISVD that binds LAG3 comprises the amino acid sequence:
(SEQ ID NO: 64)
EVQLVESGGGVVQPGGSLRLSCAASGRTFSDYVMGWFRQAPGKEREFVA
AISESGGRTHYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTALYYCAT
TLLWWTSEYAPIKANDYDYWGQGTLVTVSS
or
(amino acids 1-128 of SEQ ID NO: 96)
DVQLVESGGGVVQPGGSLRLSCAASGRTFSDYVMGWFRQAPGKEREFV
AAISESGGRTHYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTALYYCA
TTLLWWTSEYAPIKANDYDYWGQGTLVTVSS;
and optionally comprising a half-life extender and/or a C-terminal extender.
3. The method of claim 1 , wherein the LAG3 binder is in association with a further therapeutic agent.
4. The method of claim 1 , wherein the LAG3 binder further includes a C-terminal extender, which is an alanine residue.
5. The method of claim 1 , wherein the LAG3 binder further includes a half-life extender comprising an ISVD that binds human serum albumin wherein the ISVD comprises a CDR1 comprising the amino acid sequence GFTFSSFGMS (SEQ ID NO: 60) or SFGMS (SEQ ID NO:151); a CDR2 comprising the amino acid sequence SISGSGSDTLYADSVKG (SEQ ID NO: 61) or SISGSGSDTL (SEQ ID NO:152); and a CDR3 comprising the amino acid sequence GGSLSR (SEQ ID NO: 62).
6. The method of claim 1 , wherein the LAG3 binder further includes a half-life extender comprising an ISVD that binds human serum albumin wherein the ISVD comprises the amino acid sequence
(SEQ ID NO: 142)
EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWV
SSISGSGSDTLYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCT
IGGSLSRSSQGTLVTVSS.
7. The method of claim 1 , wherein the LAG3 binder comprises (i) an ISVD that binds LAG3 comprising the amino acid sequence
(SEQ ID NO: 64
EVQLVESGGGVVQPGGSLRLSCAASGRTFSDYVMGWFRQAPGKEREFVA
AISESGGRTHYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTALYYCAT
TLLWWTSEYAPIKANDYDYWGQGTLVTVSS;
or
(amino acids 1-128 of SEQ ID NO: 96)
DVQLVESGGGVVQPGGSLRLSCAASGRTFSDYVMGWFRQAPGKEREFVA
AISESGGRTHYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTALYYCAT
TLLWWTSEYAPIKANDYDYWGQGTLVTVSS;
(ii) a half-life extender comprising an ISVD that binds human serum albumin and comprises the amino acid sequence
(SEO ID NO: 142)
EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVS
SISGSGSDTLYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTI
GGSLSRSSQGTLVTVSS;
and, (iii) a C-terminal extender comprising an alanine residue.
8. The method of claim 7 , wherein the LAG3 binder further includes a polypeptide linker that links the C-terminus of the ISVD that binds LAG3 to the N-terminus of the ISVD that binds human serum albumin, wherein the polypeptide linker comprises the amino acid sequence set forth in SEQ ID NO: 58.